SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018664 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018664
Domain Number 1 Region: 577-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-83
Family Eukaryotic proteases 0.0000000119
Further Details:      
 
Domain Number 2 Region: 365-466
Classification Level Classification E-value
Superfamily Kringle-like 7.49e-39
Family Kringle modules 0.00000926
Further Details:      
 
Domain Number 3 Region: 89-183
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-37
Family Kringle modules 0.00000947
Further Details:      
 
Domain Number 4 Region: 272-364
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-36
Family Kringle modules 0.00000997
Further Details:      
 
Domain Number 5 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 6.28e-34
Family Kringle modules 0.00000662
Further Details:      
 
Domain Number 6 Region: 466-563
Classification Level Classification E-value
Superfamily Kringle-like 8.46e-34
Family Kringle modules 0.00000899
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.08e-21
Family Hairpin loop containing domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018664   Gene: ENSPANG00000007072   Transcript: ENSPANT00000021927
Sequence length 812
Comment pep:known_by_projection chromosome:PapAnu2.0:4:155901031:155950862:1 gene:ENSPANG00000007072 transcript:ENSPANT00000021927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHKEVVLLLLLFLKSGQGEPLDDYVNTKGASLFSITKKQLRAGSIEECAAKCEEEEEFT
CRSFQYHSKEQQCVIMAENRKSSIVFRMRDVILFEKKVYLSECKTGNGKNYRGTMSKTKT
GITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDEQGPWCYTTDPEHRFDYCDIPE
CEDECMHCSGENYYGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDGE
PRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGDVAVTVSGHTCQRWS
AQTPHIHNRTPENFPCKNLDENYCRNPDGEKAPWCYTTDSQVRWEYCKIPSCESSPVSTE
PLDPTAPPELTPVVQECYYGDGQSYRGTSSITVTGKKCQSWSSMTPHWHQRTPENYPNAG
LTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEGSVAAPPPVAQLPDAETPSEED
CMFGNGKRYRGKKATTVTGTPCQEWAAKEPHSHLIFTPETYPRAGLEKNYCRNPDGDVGG
PWCYTTNPRKLYDYCDVPQCASSSFDCGKPQVEPKKCPGRVVGGCVAHAHSWPWQVSLRT
RFGMHFCGGTLISPEWVLTAAHCLEKSPRPSFYKVILGAHQEVRLEPHVQEIEVSKMFSE
PAGADIALLKLSSPAIITDKVIPACLPSPNYVVADRTECFITGWGETQETGTYGAGLLKE
ARLPVIENKVCNRYEFLNGRVKSTELCAGHLAGGTDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Download sequence
Identical sequences ENSPANP00000018664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]