SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000018928 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000018928
Domain Number 1 Region: 853-1164
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.28e-69
Family Complement components 0.0000402
Further Details:      
 
Domain Number 2 Region: 1386-1536
Classification Level Classification E-value
Superfamily TIMP-like 5.76e-40
Family Netrin-like domain (NTR/C345C module) 0.00000014
Further Details:      
 
Domain Number 3 Region: 1234-1387
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 1.31e-29
Family Alpha-macroglobulin receptor domain 0.0021
Further Details:      
 
Domain Number 4 Region: 539-610
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 2.49e-22
Family Anaphylotoxins (complement system) 0.0000153
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000018928
Domain Number - Region: 678-710
Classification Level Classification E-value
Superfamily E set domains 0.049
Family SVA-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000018928   Gene: ENSPANG00000025822   Transcript: ENSPANT00000027698
Sequence length 1536
Comment pep:known_by_projection chromosome:PapAnu2.0:15:13729425:13829573:1 gene:ENSPANG00000025822 transcript:ENSPANT00000027698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMDFSSFIQTNLFILQTNQDPEGSEVDMVEEIDHIGIISFPDFKIPSNPSQFARYGMWT
IQAKYKEDFSTTGTAFFEVKEYVLPHFSVSVEPESNFIGYKNFKNFEITIKARYFYNKVV
TEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDLNN
KYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYSIKVQVKDALD
QLVGGVPVTLNAQTIDVNQETSDLEPRKSVTRVDDGVASFVVNLPSGVTVLEFNVKTDAP
DLPDENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEYLNIIVTPKSPYIDKITHYN
YLILSKGKIIHFGTREKLSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDSVW
LNIEEKCDNQLQVHLSPDADTYSPGQTVSLNMVTGMDSWVALTAVDSAVYGVQRRAKKPL
ERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEIIRPRRMLQ
KKIEEIAAKYKHLVVKKCCYDGARINHDETCEQRAARISVGPRCVKAFTECCVVASQLRA
NNSHKDLQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSVTTWEIQ
GVGISNSGICVADTIKAKVFKDVFLEMNIPYSVVRGEQVQLKGTVYNYRTSGMQFCVKMS
AVEGICTSESPVIDHQGTKSSKCVRQKVEGSSNHLVTFTVLPLEIGLQNINFSLETSFGK
EILVKSLRVVPEGVKRESYSGITLDPRGIYGTMSRRKEFPYRIPLDLVPKTEIKRILSVK
GLLVGEILSAVLSREGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSDPLI
EKRNLEKKLKEGMVSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVHKYVEQNQNSI
CNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFDICP
LVKINTALIKADTFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREALVKG
NPPIYRFWKDSLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPIIKWLSEEQRY
GGGFYSTQDTINAIEGLTEYSLLVKQLRLNMDIDVAYKHKGPLHNYKMTDKNFLGRPVEV
LLNDDLVVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYK
RIVACASYKPSREESSSGSSHAVMDISLPTGINANEEDLKALVEGVDQLFTDYQIKDGHV
ILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQKVC
EGATCKCIEADCGQMQKELDLTISAETRKQTACNPEIAYAYKVSITSITTENVFVKYKAT
LLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFTFRYIYPLD
SLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC
Download sequence
Identical sequences ENSPANP00000018928

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]