SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019101 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019101
Domain Number 1 Region: 127-377
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.03e-80
Family Carbonic anhydrase 0.00000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019101   Gene: ENSPANG00000025432   Transcript: ENSPANT00000026695
Sequence length 448
Comment pep:known_by_projection chromosome:PapAnu2.0:15:40333452:40341061:-1 gene:ENSPANG00000025432 transcript:ENSPANT00000026695 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPLCPSPWLPLLIPAPAPGLTVQLLLSLLLLVPAHPQRLPRMQEDSPLGGGSSGEDDQL
HEEDLPSEEDPPREEDPPREEDLPEVKPKSEEGSLKLEDLPTVEAPGDPQEPQNNAHGDK
KGDNQRHWRYGGDPPWPQVSPACAGRFQSPVDIRPQLAAFCPALRPLELLGFELPLLPEL
RLRNNGHSVQLTLPSGLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVV
HLSTAYARVEEALGHPGGLAVLAAFLEEGPEENSAYEQLLSHLEEIAEEGSETQVPGLDV
SALLPSDLSRYFRYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHTLSDALWGPGDSRLQL
NFRVTQPLNGRVIEASFPAGVDSSPRAAEPVQLNSCLAAGDILALVFGLLFAVTSVAFLV
QMRRQHRHRRGTNGGVSYHPAEVAETGA
Download sequence
Identical sequences ENSPANP00000019101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]