SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019299 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019299
Domain Number 1 Region: 14-496
Classification Level Classification E-value
Superfamily ALDH-like 4.32e-184
Family ALDH-like 0.0000000000000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019299   Gene: ENSPANG00000024925   Transcript: ENSPANT00000025206
Sequence length 501
Comment pep:known_by_projection chromosome:PapAnu2.0:15:79690142:79748774:-1 gene:ENSPANG00000024925 transcript:ENSPANT00000025206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSGKPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKADV
DKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYL
NDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKI
GPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDID
KVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQG
QCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIES
GKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
ANNTFYGLSAGVFTNDIDKAVTISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGE
YGFHEYTEVKTVTVKISQKNS
Download sequence
Identical sequences A0A2K5KYV1 A0A2K5ZM37
XP_011820525.1.47321 XP_011912115.1.92194 XP_011912116.1.92194 ENSPANP00000019299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]