SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019376 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019376
Domain Number 1 Region: 44-119
Classification Level Classification E-value
Superfamily Peptidyl-tRNA hydrolase-like 0.000000000000126
Family Peptidyl-tRNA hydrolase-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019376   Gene: ENSPANG00000024832   Transcript: ENSPANT00000024717
Sequence length 179
Comment pep:known_by_projection chromosome:PapAnu2.0:15:96851542:96852512:1 gene:ENSPANG00000024832 transcript:ENSPANT00000024717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSGGGVRAGNGGSMRPRGFLGAGQWLSRAMSRCVLEPRPPGKRWMVAGLGNPGLPGTRH
SVGMAVLGQLARRLGVAESWTRDRHCAADLALAPLGDAQLVLLRPRRLMNANGRSVARAG
ELRAPGTGGPAEGVGGEGGSAGARAGLAVTDPRVHLQVPVELQLLHGLGYLWGPPFLYK
Download sequence
Identical sequences ENSPANP00000019376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]