SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019400 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019400
Domain Number 1 Region: 393-695
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.98e-72
Family Protein kinases, catalytic subunit 0.000000465
Further Details:      
 
Domain Number 2 Region: 230-352
Classification Level Classification E-value
Superfamily Kringle-like 5.07e-35
Family Kringle modules 0.00026
Further Details:      
 
Domain Number 3 Region: 47-100
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000163
Family I set domains 0.038
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019400
Domain Number - Region: 124-211
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0392
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019400   Gene: ENSPANG00000024806   Transcript: ENSPANT00000024564
Sequence length 892
Comment pep:known_by_projection chromosome:PapAnu2.0:15:101090921:101142050:-1 gene:ENSPANG00000024806 transcript:ENSPANT00000024564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IWLQKRLILPASALVCEVEVPDPNDPLGPLDGQDGPIPTLKGYFLNFLEPVNNITIVQGQ
TAILHCKVAGNPPPNVRWLKNDAPVVQEHGMKTITATGVLFVRLGPTHSPNHNFQDDYHE
DGFCQPYRGIACARFIGNRTIYVDSLQMQGEIENRITAAFTMIGTSTHLSDQCSQFAIPS
FCHFVFPLCDARSRAPKPRELCRDECEVLESDLCRQEYTIARSNPLILMRLQLPKCEALP
MPESPDAANCMRIGIPAERLGRYHQCYNGSGTDYRGTASTTKSGHQCQPWALQHPHSHHL
SSTDFPELGGGHAYCRNPGGQMEGPWCFTQNKNVRMELCDVPSCSPRDSSKMGILYILVP
SIAIPLVIACLFFLVCMCRNKQKASASTPQRRQLMASPSQDMEMPLINQHKQAKLKEISL
SAVRFMEELGEDRFGKVYKGHLFGPAPGEQTQAVAIKTLKDKAEGPLREEFRHEAMLRAR
LQHPNIVCLLGVVTKDQPLSMIFSYCSHGDLHEFLVMRSPHSDVGSTDDDRTVKSALEPP
DFVHLVAQIAAGMEYLSSHHVVHKDLATRNVLVYDKLNVRISDLGLFREVYAADYYKLLG
NSLLPIRWMAPEAIMYGKFSIDSDIWSYGVVLWEVFSYGLQPYCGYSNQDVVEMIRNRQV
LPCPDDCPAWVYALMIECWNEFPSRRPRFKDIHSRLRAWGNLSNYNSSAQTSGASNTTQT
SSLSTSPVSNVSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAY
GAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSVADRAALL
SEGTEDAQNAPEDGAQSPVQEAEEEEGSVPETELLGDSDTLQVDEAQVQLEA
Download sequence
Identical sequences ENSPANP00000019400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]