SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019478 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019478
Domain Number 1 Region: 232-295
Classification Level Classification E-value
Superfamily RILP dimerisation region 1.96e-17
Family RILP dimerisation region 0.0000296
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000019478
Domain Number - Region: 72-117
Classification Level Classification E-value
Superfamily BLRF2-like 0.0327
Family BLRF2-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019478   Gene: ENSPANG00000024606   Transcript: ENSPANT00000024214
Sequence length 389
Comment pep:known_by_projection chromosome:PapAnu2.0:16:1427294:1430578:-1 gene:ENSPANG00000024606 transcript:ENSPANT00000024214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRRAVAPGWGSRETAELVYHLAGALGTELQELARRFGPEAAAGLVPLVVRALELLEQA
AVGPAPDSLQVSAQQAEQELRRLREENERLRRELRAGPQEERALLRQLKEVTDRQRDELR
AHNRDLRQRGQETEALQEQLQRLLLVNAELRHKLAAVQIQLRAAQDRERERQQLGEAATP
PAKERAWGQAGAPGHQHVQEPEWMTAGAGASEDPAEAAQQLGCPSEAGQCFSREEFEQIL
QERNELKAKVFLLKEELAYFQRELLTDHRVPGLLLEAMKVAVRKQRKKIKAKMLGTPEEA
ESSDDEDGSWLLLSDDKGDHPPPPESKIQSFFGLWYRGKAESPEDETDSPAPSKLGGEEE
AQPQSPAPDPPCSALHEHLCLGASAAPEA
Download sequence
Identical sequences A0A096P2A3
ENSPANP00000019478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]