SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019661 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019661
Domain Number 1 Region: 8-91
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000419
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019661   Gene: ENSPANG00000023840   Transcript: ENSPANT00000022977
Sequence length 922
Comment pep:known_by_projection chromosome:PapAnu2.0:16:7843039:7852869:-1 gene:ENSPANG00000023840 transcript:ENSPANT00000022977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWMKGLAPLLGYLPHGPPRGPDVLLFLHPEDRPLMLAIHKKILQLAGQPFDHSPIRFCAR
NGEYVTMDTSWAGFVHPWSRKVAFVLGRHKVRTAPLNEDVFTPPAPSPAPTLDTDIQELS
EQIHRLLLQPVHSPSPTGLCGVGPVTSPGLLHSPGSSSDSNGGDAEGPGPPAPVTFQQIC
KDVHLVKHQGQQLFIESRARPQPRPRLPATGTFKARALPCQSPDPELETGSAPIPAPLAL
APEEAERKEASSCSYQQINCLDSILRYLESCNLPSTTKRKCASSSSYTTSSASDDDKQRT
GPVPVGTKKDPPSAVLSGEGAAPRKEPVVGGTLSPLALANKAESVVSVTSQCSFSSTIVH
VGDKKPPESDIIMMEDLPGLAPGPAPSPAPSPTVAPDPAPDAYRPVGLTKAVLSLHTQKE
EQAFLSRFRDLGRLRGLDSSSTAPSALGERGCHHGPAPPSRRHHCRSKAKRSRHHQSPRA
EAPCYVSHPSPVPPSTPWPAPPATTPFPAVVQPYPLPVFSPRGGPQPLPPAPTSVPPAAF
PTPLVTPMVALVLPNYLFPTPSSYPYGAPQTPVEGPPTPASYSPSPSLPALPPSPPRRPD
SPLFNSRCSSPLQLNLLQLEELPRAEGAAGAGGPGSSAGPPPPSEEAAEPEARLVEVTES
SNQDALSGSSDLLELLLQEDSRSGTGSAASGSLGSGLGSGSGSGSHEGGSTSASITRSSQ
SSHTSKYFGSIDSSEAEAGAARGGAEPGDQVIKYVLQDPIWLLMANADQRVMMTYQVPSR
DMTSVLKQDRERLRAMQRQQPRFSEDQRRELGAVHSWVRKGQLPRALDVMACVDCGSSTQ
DPGHPDDPLFSELDGLGLEPMEEGGGEQGSSGGGSGEGEGCEEARAQGGAKASSFQDLAM
EEEKESRSSASPALPTAGNGTS
Download sequence
Identical sequences ENSPANP00000019661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]