SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019670 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019670
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 6.28e-59
Family Ran-binding protein mog1p 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019670   Gene: ENSPANG00000023799   Transcript: ENSPANT00000023043
Sequence length 186
Comment pep:known_by_projection chromosome:PapAnu2.0:16:7959839:7960984:1 gene:ENSPANG00000023799 transcript:ENSPANT00000023043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPMRDCPLFGGAFSAILPTGAIDVSDLRPVPDNQEVFCHPVTDQSLIVELLELQAHVQG
EAAARYHFEDVGGVQGARAVHVESVQPLSLENLALRGCCQEAWGLSGKQQIAKENQQVAK
DVTLHQALLRLPQYQTDLLLTFNQPPPDNRSSLGPENLSPPPWSLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences A0A096P2U5 A0A2K5Z6X2
XP_011849885.1.47321 ENSPANP00000019670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]