SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019774 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019774
Domain Number 1 Region: 46-473
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-128
Family ALDH-like 0.0000000000377
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019774   Gene: ENSPANG00000023617   Transcript: ENSPANT00000022180
Sequence length 529
Comment pep:known_by_projection chromosome:PapAnu2.0:16:18812280:18867472:1 gene:ENSPANG00000023617 transcript:ENSPANT00000022180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFMVCIERWTFEIGNFLAGLMDVTELGAQGIIYELALVAYMDQAMEREVQRVRQAFLSGR
SRPLRFRLQQLEALRRMVQEREKDILAAIAADLCKSELNAYSQEVITVLGEIDFMLENLP
EWVTAKPVKKNLLTMMDEAYIQPQPLGVVLIIGAWNYPFVLIIQPLIGAIAAGNAVIIKP
SELSENTAKIVAKLLPQYLDQDLYVVINGGVEETTELLKQRFDHIFYTGNTAVGKIVMEA
AAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQTCIAPDYILCEASLQSQ
IVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKIALGGETDEATRYIAPT
VLTDVDPKTKVMQEEIFGPVLPIVPVKNVDEAIDFINEREKPLALYVFSHNHKLIKRMID
ETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFSHQRPCLLKSLKREGAN
KLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLFTFLGIVAAVLVKAGYY
Download sequence
Identical sequences A0A096P349
ENSPANP00000019774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]