SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019776 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019776
Domain Number 1 Region: 4-434
Classification Level Classification E-value
Superfamily ALDH-like 7.59e-135
Family ALDH-like 0.00000000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019776   Gene: ENSPANG00000023619   Transcript: ENSPANT00000022182
Sequence length 453
Comment pep:known_by_projection chromosome:PapAnu2.0:16:18923432:18931386:-1 gene:ENSPANG00000023619 transcript:ENSPANT00000022182 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALRRLIQEREQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHLEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIVMTAAAQHLTPVTLELGGKSPCYVDKNCGLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMSLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYVFSSNDKVIKKMIAETSSGGVTANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRSLMNDEALKVRYPPSPAKMTWH
Download sequence
Identical sequences A0A096P351
ENSPANP00000019776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]