SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019926 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019926
Domain Number 1 Region: 88-279
Classification Level Classification E-value
Superfamily Cytochrome c 6.71e-74
Family Cytochrome bc1 domain 0.00000000991
Further Details:      
 
Domain Number 2 Region: 280-325
Classification Level Classification E-value
Superfamily Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00000000000000366
Family Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019926   Gene: ENSPANG00000023184   Transcript: ENSPANT00000021355
Sequence length 325
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684880.1:187067:190129:1 gene:ENSPANG00000023184 transcript:ENSPANT00000021355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAASLRGLVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHGGFLSSLDHTSIRRGFQVYKQV
CSSCHSMDFVAYRHLVGVCYTENEAKALAAEVEVQDGPNENGEMFMRPGKLYDYFPKPYP
NTEAARAANNGALPPDLSYIVRARHGGEDYIFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AISMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMAALLV
PLIFIMKRHKWSVLKSRKLAYRPPK
Download sequence
Identical sequences A0A096P3K1
ENSPANP00000019926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]