SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000019954 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000019954
Domain Number 1 Region: 350-490
Classification Level Classification E-value
Superfamily C-type lectin-like 8.59e-41
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 2 Region: 932-1083
Classification Level Classification E-value
Superfamily C-type lectin-like 2.16e-39
Family C-type lectin domain 0.00057
Further Details:      
 
Domain Number 3 Region: 645-779
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-38
Family C-type lectin domain 0.000000111
Further Details:      
 
Domain Number 4 Region: 789-925
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-37
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 5 Region: 1221-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 2.7e-35
Family C-type lectin domain 0.00021
Further Details:      
 
Domain Number 6 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.11e-34
Family Cysteine rich domain 0.000000872
Further Details:      
 
Domain Number 7 Region: 500-638
Classification Level Classification E-value
Superfamily C-type lectin-like 3.81e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 8 Region: 230-345
Classification Level Classification E-value
Superfamily C-type lectin-like 1.34e-29
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 9 Region: 1091-1217
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-27
Family C-type lectin domain 0.0017
Further Details:      
 
Domain Number 10 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 6.57e-20
Family Fibronectin type II module 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000019954   Gene: ENSPANG00000023160   Transcript: ENSPANT00000021239
Sequence length 1456
Comment pep:known_by_projection chromosome:PapAnu2.0:9:17449564:17547786:1 gene:ENSPANG00000023160 transcript:ENSPANT00000021239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFASVIPGAVLLLDTRQFLIYNEDHKRCVEAVSPSAVQTAACNQDAESQKFRW
VSESQIMSVAFKLCLGVPSKTDWVAITLYACDSKSEFQKWECKNDTLLGIKGEDLFFNYG
NRQEKNVMLYKGSGLWSRWKIYGTTDNLCSRGYEAMYTLLGNANGATCAFPFKFENKWYA
DCTSAGRSDGWLWCGTTTDYDTDKLFGYCPLKFEGSESLWNKDPLTSISYQINSKSALMW
HQARKSCQQQNAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGWQWSDRSPFRY
LNWLPGSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNSFVIPSESDVPT
HCPSQWWPYAGHCYKIHKDEKKIQRDALIACRREGGDLASIHTIEEFDFIISQLGYEPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVVMKGKDGYWADRGCEW
PLGYICKMKSRSQGPEIVEVEEGCKKGWKKHHFYCYMIGHTLSTFAEANQTCNNENAYLT
TIEDRYEQAFLTSFVGLRPEKYFWTGLSDIQTKGTFQWTIEEEVRFTHWNSDMPGRKPGC
VAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTHPPKPTTTPEPKCPEDWGASSRTSLCF
KLYAKGKHEKKTWFESRDFCRALGGDLASINNKEEQQTIWRLITASGSYHELFWLGLTYG
SPSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDPSMSWNDINCEHLNNWICQIH
KGQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKEKETMDNARAFCKRNFGDLVSIQS
ESEKKFLWKYVNRNDAQSAYFIGLLISLDKKFAWMDGSKVDYVSWATGEPNFANEDENCV
TMYSNSGFWNDINCGYPNAFICQRHNSSINATTVMPTKPSVPSGCKEGWNFYNNKCFKIF
GFVEEERKTWQEARKACIGFGGNLVSIQNEKEQAFLTYHMKDSTFSAWTGLNDVNSEHTF
LWTDGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGASNEAGKWMDDTCDGKRGYICQ
TRSDPSLTNPPATIQTDGFINYGKSSYSLMRQKFQWHEAEIYCKLHNSLIASILDPYSNA
FAWLQMETSNERVWIALNSNLTDSQYTWTDKWRVRYTNWAADEPKLKSACVYLDLDGYWK
TAYCNESFYFLCKRSDEIPATEPPQLPGRCPESDHTAWIPFHGHCYYIESSYTRNWGQAS
LECLRMGSSLVSIESAAESSFLSYRVEPLKSKTNFWIGLFRNVEGMWLWINNSPVSFVNW
NTGDPSGERNDCVALHASSGFWSNIHCSSYKGYICKRPKIIDAKPTHELLTTKADTRKMD
PSKPSSSVAGVVIIVILLILTGAGLAAYFFYKKRRVHLPQEGAFENTLYFNSQSSPGTSD
MKDLVGNIEQNEHAVI
Download sequence
Identical sequences A0A096P3M9
ENSPANP00000019954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]