SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020213 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020213
Domain Number 1 Region: 253-363,476-622
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.06e-55
Family Phosphate binding protein-like 0.00000968
Further Details:      
 
Domain Number 2 Region: 54-239
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.000000000000706
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020213   Gene: ENSPANG00000022595   Transcript: ENSPANT00000019067
Sequence length 824
Comment pep:known_by_projection chromosome:PapAnu2.0:9:44137989:44465952:1 gene:ENSPANG00000022595 transcript:ENSPANT00000019067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLAAKAARAGPRGMACFVRKIFSKNNVYKTLSRQSSCVCQLLSCFCSCSFFFSLQAVE
TNLASKDSHWVFVNEEISDPEILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLL
CDPQEGYLQMLQISNLYLYDSVLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSM
LDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSL
QERPMGSRLQGLTLKVVTVLEEPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIY
QAPDGRYGHQLHNTSWNRMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILI
KKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASATL
HSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPI
RTFQDLSKQVEMSYGTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSP
SEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVTVIGNSISSKGYGIALQHGSPYRDLFS
QRILELQDTGDLDVLKQKWWPHMGRCDLTSHASAQADGKSLKLHSFAGVFCILAIGLLLA
CLVAALELWWNSNRCHQETPKEDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEM
GGLAPTQTLEPTREYQNTQLSVSTFLPEQSSHGTSRTLSSVPSSNLPLPLSSSATMPSMQ
CKHRSPNGGLFRQSPVKTPIPMSFQPVPGGVLPESLDTSHGTSI
Download sequence
Identical sequences ENSPANP00000020213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]