SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020280 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020280
Domain Number 1 Region: 164-425
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.52e-80
Family Eukaryotic proteases 0.00000000111
Further Details:      
 
Domain Number 2 Region: 47-159
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-32
Family Kringle modules 0.0000089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020280   Gene: ENSPANG00000022455   Transcript: ENSPANT00000018428
Sequence length 433
Comment pep:known_by_projection chromosome:PapAnu2.0:9:55824660:55830910:-1 gene:ENSPANG00000022455 transcript:ENSPANT00000018428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLAHLLLCVLVVSDSKGSRELQVPSDCGCLNGGTCMSNKYFSSIHWCNCPKKFGGQH
CEIDKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSATVLQQTYHAHRSDALQLGLGKHNY
CRNPDNRRRPWCYVQVGLKQRVQECMVHNCADGKKPSSPPEELQFQCGQRTLRPRFKIVG
GEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVVSATHCFINYPKKEDYIVYLGR
SRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLP
SMYNDPNDPPFGTSCEITGFGKENSTDYLYPEQLKMTVVKLVSHQKCQQPHYYGSEVTTK
MLCAADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWGRGCALKDKPGVYTRVSRFLPW
IHSHTREQNGLAL
Download sequence
Identical sequences A0A096P4K5
ENSPANP00000020280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]