SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020533 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020533
Domain Number 1 Region: 272-314
Classification Level Classification E-value
Superfamily RING/U-box 0.000000353
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020533
Domain Number - Region: 183-241
Classification Level Classification E-value
Superfamily Plus3-like 0.00458
Family Plus3 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020533   Gene: ENSPANG00000021973   Transcript: ENSPANT00000004103
Sequence length 331
Comment pep:novel chromosome:PapAnu2.0:9:79610760:79611894:1 gene:ENSPANG00000021973 transcript:ENSPANT00000004103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVFLVMLYEYSPLFYIVVVFTCFVVTTGLVLGWFGWDVPVILRNSEETQVSTRVFKKQ
MRQVKNPFGLEITNPSSASITTGITLTTDCLEDSLLTCYWGCSVQKLYDALQKHVYCFRI
STPQALEDALYSEYLYQEQYFIKKDSKEEIYCRLPRDNKIEDFGTVPTSRYPLVALLTLA
DEDDREIYDIISVVSVIHIPDRTYKLSCRILYQYLLLAQGQFHDLKQLFMSANNNFTPSN
CSSSEEKNTGRSLLEKVRLSKSEVEPSENSKDCVVCQNGTVNWVLLPCRHTCLCDGCMKY
FQQCPICRQFLQESFALCSQKEQDKDKLKTL
Download sequence
Identical sequences A0A096P5A8
ENSPANP00000020533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]