SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020768 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000020768
Domain Number - Region: 50-96
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0484
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020768   Gene: ENSPANG00000021314   Transcript: ENSPANT00000013768
Sequence length 261
Comment pep:known_by_projection chromosome:PapAnu2.0:16:50581472:50584464:-1 gene:ENSPANG00000021314 transcript:ENSPANT00000013768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKIGSRRWMLQLIMQLGSVLLTRCPFWGCFSQLMLYAERAEARRKPDIPVPYLYFDMG
AAVLCASFMSFGVKRRWFALGAALQLAISTYAAYIGGYVHYGEWLKVSASTPKGASLWRW
VVLHSGKPGEMWPLQFLTGVPLPRPRSVCTRAQLYLICVAYSLQHSKEDRLAYLNHLPGG
ELMIQLFFVLYGVLALAFLSGYYVTLAAQILAVLLPPVMLLIDGNVAYWHNTRRVEFWNQ
MKLLGESVGIFGTAVILATDG
Download sequence
Identical sequences ENSPANP00000020768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]