SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020893 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020893
Domain Number 1 Region: 343-477
Classification Level Classification E-value
Superfamily C-type lectin-like 3.21e-42
Family C-type lectin domain 0.0000917
Further Details:      
 
Domain Number 2 Region: 488-623
Classification Level Classification E-value
Superfamily C-type lectin-like 3.26e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 199-335
Classification Level Classification E-value
Superfamily C-type lectin-like 9.96e-34
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 4 Region: 930-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-33
Family C-type lectin domain 0.00041
Further Details:      
 
Domain Number 5 Region: 797-923
Classification Level Classification E-value
Superfamily C-type lectin-like 4.22e-33
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 6 Region: 631-781
Classification Level Classification E-value
Superfamily C-type lectin-like 5.4e-29
Family C-type lectin domain 0.00067
Further Details:      
 
Domain Number 7 Region: 1226-1366
Classification Level Classification E-value
Superfamily C-type lectin-like 2.65e-27
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 8 Region: 5-137
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.38e-26
Family Cysteine rich domain 0.0047
Further Details:      
 
Domain Number 9 Region: 1105-1229
Classification Level Classification E-value
Superfamily C-type lectin-like 1.86e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 10 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 1.28e-20
Family Fibronectin type II module 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020893   Gene: ENSPANG00000021066   Transcript: ENSPANT00000006081
Sequence length 1449
Comment pep:known_by_projection chromosome:PapAnu2.0:16:54508018:54534405:1 gene:ENSPANG00000021066 transcript:ENSPANT00000006081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPEPNVFLIFSHGLQGCLEAQGGQVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGT
GWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGARTSNISKPGTLERGDQTRSG
QWRIYGSEEDLCALPYHEVYTIQGNSHGKPCTIPFKYDNQWFHGCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTCTPLLSGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEE
NCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHC
YRLQAEKRSWQESKKACLRGGGDLVSIHSMAELEFITKQIKQAPPEVEELWIGLNDLKLQ
MNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQL
SQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSS
LIYNWEGEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLW
EVKNCTSFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDPKLRYCYKVFSSER
LQDKKSWVQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNR
RDPRGGQSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCDTQLDWICKI
PRGTDVREPDDSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELTSVHSQAELE
FLGHNLQKFSRAQEQHWWIGLHTSESDGRFRWTDGSIINFISWAPGKPRPVGKDKKCVYM
TASREDWGDQRCLTALPYICKRSNVTKETQPPDLPTTALGGCPSGWIQFLNKCFQVQGQD
PQSRVKWSEAQFSCEQQEAQLVTITNPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQ
EPLMYANWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKG
TVPGVQPSPGLVPGNGGTELSYLNGTFRLLQKPLRWHDALLLCESRNASLAYVPDPYTQA
FLTQAARGLRTPLWIGLAGEEGSRRYSWVSEEPLNYVGWQDGEPQQPGGCTYVDVDGAWH
TTSCDTKLQGAVCGVSSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKE
ARQRCQRAGGAVLSILDEMENVFVWEHLQSYEGQSRGAWLGMNFNPKGGTLVWQDNTAVN
YSNWGPPGLGPSMLSHNSCYWIQSNSGLWRPGACTNVTMGVVCKLPRAEQSSFSPSALPE
NPAALVVVLMAVLLLLALLTAALILYRRRQSIERGAFEGARYSRSSSSPTEATEKNILVS
DMEMNEQQE
Download sequence
Identical sequences ENSPANP00000020893

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]