SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000020937 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000020937
Domain Number 1 Region: 139-389
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.76e-72
Family Extended AAA-ATPase domain 0.00000164
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000020937
Domain Number - Region: 48-69
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00667
Family RILP dimerisation region 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000020937   Gene: ENSPANG00000020980   Transcript: ENSPANT00000023467
Sequence length 406
Comment pep:known_by_projection chromosome:PapAnu2.0:16:55679265:55683762:1 gene:ENSPANG00000020980 transcript:ENSPANT00000023467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDGPEQMELEEGKAGSGLRQYYLSKIEELQVRTDFRESXXXXXXAQRNELNAKVRLLR
EELQLLQEQGSYVGEVVRAMDKKKVLVKVHPEGKFVVDVDKNIDINDVTPNCRVALRNDS
YTLHKILPNKVDPLVSLMMVEKVPDSTYEMIGGLDKQIKEIKEVIELPVKHPELFEALGI
AQPKGVLLYGPPGTGKTLLARAVAHHTDCTFIRVSGSELVQKFIGEGARMVRELFVMARE
HAPSIIFMDEIDSIGSSRLEGGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDI
LDSALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVK
GVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK
Download sequence
Identical sequences ENSPANP00000020937

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]