SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000054 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000054
Domain Number 1 Region: 1233-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-51
Family DBL homology domain (DH-domain) 0.00000000741
Further Details:      
 
Domain Number 2 Region: 1415-1533
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-33
Family Pleckstrin-homology domain (PH domain) 0.000000529
Further Details:      
 
Domain Number 3 Region: 250-386
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-21
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 4 Region: 1047-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 7.08e-21
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 5 Region: 797-950
Classification Level Classification E-value
Superfamily Spectrin repeat 5.25e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 6 Region: 471-612
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 7 Region: 6-160
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000000000772
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 8 Region: 1584-1653
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000227
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 9 Region: 617-724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000456
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 10 Region: 164-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000236
Family Spectrin repeat 0.0054
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000054
Domain Number - Region: 391-503
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0528
Family Spectrin repeat 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000054   Gene: ENSPANG00000016240   Transcript: ENSPANT00000005859
Sequence length 1664
Comment pep:known_by_projection chromosome:PapAnu2.0:6:14281147:14429033:1 gene:ENSPANG00000016240 transcript:ENSPANT00000005859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYLACIPSEEV
CKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTNFGSSKFEF
ETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHMLSRLEELQD
ILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSESFPKKNSGS
GNADLQNLLPKVSTMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWITHN
KGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVESGHYASQQI
RQIASQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEVDLPSELQD
LEDAIHHHQGIYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYSKAVHHVLD
VIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLSKHTGVGKS
LHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDF
VRRVEQRKILLDMSVSFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQT
TLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSINHIETVLQQLDEAQSQMEELFQERK
IKLELFLQLRIFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHHADKALTMN
NLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQH
RKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEK
THQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVNASVAFYKT
SEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFLKACTLARR
NADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRKRRLDQCQQ
YVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQTKERVKLL
IQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSDSNKSSKSL
QLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDLRECMDTYL
WEMTSGVEEIPPGIVNKELIIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGHCFVTWADK
FQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITKYQLLLKEL
LTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQESFQVWDPKT
LIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEGDPCKFALWV
GRTPTSDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKTAPATRQKGR
RDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTACNSNELTIRR
GQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPLWLTVHRPLPK
Download sequence
Identical sequences ENSPANP00000000054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]