SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000404 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000404
Domain Number 1 Region: 864-1075
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-54
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1238-1424
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-26
Family Pleckstrin-homology domain (PH domain) 0.00000719
Further Details:      
 
Domain Number 3 Region: 1064-1184
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000404   Gene: ENSPANG00000004927   Transcript: ENSPANT00000001249
Sequence length 1428
Comment pep:known_by_projection chromosome:PapAnu2.0:11:94498780:94630811:-1 gene:ENSPANG00000004927 transcript:ENSPANT00000001249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKPPVAPKPKFVVANNKPTPPPIAPKPDIVISSVPQSTKKMKPAIAPKPKVLKSSPVRD
IGQSPTRKIMLNLEGHKQELAESTDNFNCKYEGDQSSDYISPMCSCSSECIHKMGHRENL
CVKQLVLEPVEMNENLENSKIDETLTIQTRSKCDLYGEKAKNQGGVVLKASILEEKLKDA
LIHRMPPFISAQKHRSTDSPEMNGGCNSDGQFRIEFTDLSPSPSSFEKVPDHHSCHLQLP
SDECENFETCQDDSEKSNNCFQSSELEALENGKRSTFISSDEVSKKSIVKDLGPLEIHLL
PYTPKFPTPKPRKTRTARLLRQKCVDTPSESTEEPGNSDSSSSCLTENSLKMNKISVLHQ
NVLCKQEQVDTVKLGNKSELNMESNSDAQDLVNSQKVMCHEVSSFEKMAPSFDTDSNLSS
DSTTVDGSSMSLAVDEGTGFIRCSTLSMSLPKQLKLTCNEHLQSERNLGVSAPQMQKESV
IKEENSLRIVPKKPQRHSLPTTGVLKKAASEELVEKSSYPSSEEKSSEKGLERNHLQHLC
AQNRGVSSSSDMPKRASEKPVWKLPHPILPFSGNPESLKSVTLSSNSEPSTALTKPRAKS
LSAVDVEKCTKPCKDSAKKNSFKKLLNMKLSICFMKSDFQKFWSKSSQLGDTTTGHLSSG
EQKGIESDWQGLLVGEEKRSKPIKAYSTENYSLESQKKRKKSRGQTSAANGLRAESLDDQ
MLSRESSSQAPYKSVTSLCAPEYENIRHYEEIPEYENLPFIMAIQKTRELEWQNSSSVED
TDANVYEVEEPYEAPDGQLQLGPRHQHSRSGNPENVYTDLQVWGLGDLPADEEELVNGLV
EDDVSSESSKGEPDPLDYKQDEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRDAVA
HASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLHWTEQQRIADIFVKKGPY
LKMYSTYIKEFDKNIALLDEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRIPQY
RLLLTDYLKNLIEDAGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNGHHE
IVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMKVRK
PTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLDEAD
SENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNKYGL
DYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKKIPA
ALKEVSANTEDSSMSGYLYRSKGNKKPWKHFWFVIKNKVLYTYAASEDVAALESQPLLGF
TVIQVKDENSESKVFQLRHKNMLFYLFKAEDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences ENSPANP00000000404

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]