SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000625 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000625
Domain Number 1 Region: 767-996
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-64
Family DBL homology domain (DH-domain) 0.000000000689
Further Details:      
 
Domain Number 2 Region: 368-550
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.21e-62
Family Regulator of G-protein signaling, RGS 0.0000143
Further Details:      
 
Domain Number 3 Region: 1000-1130
Classification Level Classification E-value
Superfamily PH domain-like 9.16e-39
Family Pleckstrin-homology domain (PH domain) 0.0000012
Further Details:      
 
Domain Number 4 Region: 66-146
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-22
Family PDZ domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000625   Gene: ENSPANG00000014881   Transcript: ENSPANT00000015623
Sequence length 1544
Comment pep:known_by_projection chromosome:PapAnu2.0:14:109750520:109825973:1 gene:ENSPANG00000014881 transcript:ENSPANT00000015623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TDRTLIFRFPLKKPIRHGSILNRESPTDKKQKVERIASHDFDPTDSSSKKTKSSSEESRS
EIYGLVQRCVVIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGTLVT
HSNHLEVVKLIRSGSYVALTVQGRPPGLPQIPLADSEVEPSVIGHMSPIMTSPHSPGASG
NMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTPAQRLLKEIQEAK
KHIPQLQEQLSKATGSAQDGAVVTPSRPLGDALTVSEAETDPGDGLGRTDCSSGDASRPS
SDNADSPKSGPKERIYLEENPEKSETIQDTDTQSLVGSPSTRIAPHIIGAEDDDFGTEHE
QPVRGHCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKHTNSKETRRIF
LEFHQFFLDRSAHLKVSVPDEMSADLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHLED
FRQKRSMGLTLAESELTKLDAERDKDRLTLEKERTCAEQIVAKIEEVLMTAQAVEEDKSL
QIQFVVSLWWLFSGSILSNVHNLHVSQYSSSLCPPLFSFFSHDPSSFPASSSSSLSSSCL
IPPPSPLSLHNNPLFGRAMELQKARHPKHLSTPSSVSPEPQDSAKVRQSGLANEGTDAGY
LPANSVSSVASGASFSQEGGKENDTGSKQVGETPAPGDTLDGTPRTLNTVFDFPPPPLDQ
VQEEECEVERVTEHGTPKPFRKFDSVAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPCEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHIGLNEQMKAVRKRNETSVIDQIGEDLLTWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIGKYTEWPTEREKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSSLKLSEYPNVEELRNLDLTKRKM
IHEGPLVWKVNRDKTIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPGEGDNDEEDPSKLKEEQHGMSVTGLQSPDRDLGLEATLISSKPQSHSLSTS
GKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQITIPDSHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSAQEDWQHFPRYRTASQGPQTDSVIQNSENIKAYHSGEGHMPFRTGTG
DIATCYSPRTSTESSAPRDSVGLAPQDSQASNILVMDHMIMTPEMPTMEPEGGLDDSGEH
FFDAREAHSDENPSEGDGAVNKEEKDVNLRISGNYLILDGYDPVQESSTDEEVASSLTLQ
PMTSIPAMESTHQQQHSPQNTHSDGAVSPFTPEFLVQQRWGAMEDSCFEIQSPSSCADSQ
SQIMEYIHKIEADLEHLKKVEESYTILCQRLAGSALTDKHSDKS
Download sequence
Identical sequences ENSPANP00000000625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]