SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000000967 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000000967
Domain Number 1 Region: 532-596,801-1141
Classification Level Classification E-value
Superfamily Ras GEF 1.15e-117
Family Ras GEF 0.0000137
Further Details:      
 
Domain Number 2 Region: 129-352
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-43
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 340-497
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000233
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000000967
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily PH domain-like 0.00356
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000000967   Gene: ENSPANG00000010568   Transcript: ENSPANT00000009999
Sequence length 1144
Comment pep:known_by_projection chromosome:PapAnu2.0:6:75065366:75244980:1 gene:ENSPANG00000010568 transcript:ENSPANT00000009999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QYYFTVLFGHEGQKPLELRCEEEQDGKEWMEAIHQASYADILIEREVLMQKYIHLVQIVE
TEKIAANQLRHQLEDQDTEIERLKSEIIALNKTKERMRPYQSNQEDEDPDIKKIKKVQSF
MRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFTMVEAESEYVHQLYILVNGFLRPLRM
AASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLILADLFDILLPMLNI
YQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLTYPMFQIPRYIITL
HELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLD
TSQTFIRQGSLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHL
LKTMKSEGNQDCSLKNESPDLSANGLSKGSGQVFGHLDFKIVVEPPDAAAFTVVLLAPSR
QEKAAWMSDISQCVDNIRCNGLMTVVFEENSKVTVPHMIKSDARLHKDDTDICFSKTLNS
CKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTAAVVLGKLSDIYKRPFTSI
PVRSLELFFATSQNNRGEHLVDGKSPRLCRKFSSPPPLAVSRTSSPVRARKLSLTSPLNS
KIGALDLTTSSSPTTTTQSPAASPPPHTGQIPLDLSRGLSSPEQSPGSVEENVDNPRMDL
CNKLKRSIQKAVLESAPADRAGVESSPAADTTELSPCRSPSTPRHLRYRQPGGQTADNAH
CSVSPASAFAIATAAAGHGSPPGFNNTERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDF
ELNNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCM
KAECFQSLSAMELAEQITLLDHVIFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNDM
SNLVASQIMNYADVSSRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWA
KVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTE
EGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYLLDKDLIINENTLYELSLKIEP
RLPA
Download sequence
Identical sequences ENSPANP00000000967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]