SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000001887 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000001887
Domain Number 1 Region: 79-173
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-20
Family DBL homology domain (DH-domain) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000001887   Gene: ENSPANG00000000745   Transcript: ENSPANT00000023603
Sequence length 185
Comment pep:known_by_projection chromosome:PapAnu2.0:5:96805458:96873780:1 gene:ENSPANG00000000745 transcript:ENSPANT00000023603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPKEATGKENMVTRKRIWLLRSRLYMLERRKTDTVVDSSVSGDHSGTLRRSQSDRTEYN
QKLQEKMTPQGECSVAETLTSEEEHQMKRMMAKREKIIKELIQTEKDYLNDLELCVREVV
QPLRNKKIDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGMFILFSSSTIQ
QEIIF
Download sequence
Identical sequences ENSPANP00000001887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]