SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002417 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002417
Domain Number 1 Region: 440-630
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.06e-44
Family cAMP-binding domain 0.00024
Further Details:      
 
Domain Number 2 Region: 219-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.93e-23
Family Voltage-gated potassium channels 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002417   Gene: ENSPANG00000021220   Transcript: ENSPANT00000007941
Sequence length 797
Comment pep:known_by_projection chromosome:PapAnu2.0:8:82174498:82331096:-1 gene:ENSPANG00000021220 transcript:ENSPANT00000007941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFKSLTKVNKVNPIGENNENEQSSHQNEQDSHPSNQSQQTTAQEQNKGEEKSLKTNSTLV
MSEEPHTNIQVDKLSKKNSSGDLTTNPDPQTAAEPTRTVPEQKEMDPEKEGPNSPQNKSP
AAPVINEYADAQLHNLVKRMRQRTALYKKKLVEGDLSSPEASPQTDEAKPTAVPPVKESD
DKPTEEHYYRLLCFKVKKMPLTEYLKRLKLPSSIDSYTDRLYLLWLLIVSLAYNWNCWFI
PLRLVFPYQTPDNIHYWLIVDIICDIIYLYDMLFIQPRLQIRGGDIIVDPNELRKNYRTS
TKFQLDVASIIPFDVCYLFFGFNPIFRANRMLKYTSFFEFNHHLESIMDKAYIYRVIRTT
GYLLFILHINACVYYWASNYEGIGTTRWVYDGEGNKYLRCYYWAVRTLITIGGLPEPQSG
VFVFSSLIGQMRDVIGAATANQNYFRACMDDTIAYMNNYSIPKLVQKRVRTWYEYTWDSQ
RMLDESDLLKTLPTTVQLALAIDVNFSIISKVDLFKGCDTQMIYDMLLRLKSILYLPGDF
VCKKGEIGKEMYIIKHGEVQVLGGPDGTKVLVTLKAGSVFGEISLLAAGGGNRRTANVVA
HGFANLLTLDKKTLQEILVHYPDSERILMKKARVLLKQKAKTAEATPPRKDLAFLFPPKE
ETPKLFKTLLGGKGKASLARLLKLKQEQAAQSMRADTEKQTRDSASAKHNRFKHDRLSTC
GTNGKDCTRKGGREPEEKPLDRPECTASPIAVEEEPQSVRTVFPRGTSRQSLIISMAPSA
EGGEEVLTIEVKEKAKQ
Download sequence
Identical sequences ENSPANP00000002417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]