SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000002965 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000002965
Domain Number 1 Region: 867-1078
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-54
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1241-1427
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-26
Family Pleckstrin-homology domain (PH domain) 0.00000719
Further Details:      
 
Domain Number 3 Region: 1067-1187
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-25
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000002965   Gene: ENSPANG00000004927   Transcript: ENSPANT00000022636
Sequence length 1431
Comment pep:known_by_projection chromosome:PapAnu2.0:11:94498780:94630811:-1 gene:ENSPANG00000004927 transcript:ENSPANT00000022636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSAAEMKKPPVAPKPKFVVANNKPTPPPIAPKPDIVISSVPQSTKKMKPAIAPKPKVLK
SSPVRDIGQSPTRKIMLNLEGHKQELAESTDNFNCKYEGDQSSDYISPMCSCSSECIHKM
GHRENLCVKQLVLEPVEMNENLENSKIDETLTIQTRSKCDLYGEKAKNQGGVVLKASILE
EKLKDALIHRMPPFISAQKHRSTDSPEMNGGCNSDGQFRIEFTDLSPSPSSFEKVPDHHS
CHLQLPSDECENFETCQDDSEKSNNCFQSSELEALENGKRSTFISSDEVSKKSIVKDLGP
LEIHLLPYTPKFPTPKPRKTRTARLLRQKCVDTPSESTEEPGNSDSSSSCLTENSLKMNK
ISVLHQNVLCKQEQVDTVKLGNKSELNMESNSDAQDLVNSQKVMCHEVSSFEKMAPSFDT
DSNLSSDSTTVDGSSMSLAVDEGTGFIRCSTLSMSLPKQLKLTCNEHLQSERNLGVSAPQ
MQKESVIKEENSLRIVPKKPQRHSLPTTGVLKKAASEELVEKSSYPSSEEKSSEKGLERN
HLQHLCAQNRGVSSSSDMPKRASEKPVWKLPHPILPFSGNPESLKSVTLSSNSEPSTALT
KPRAKSLSAVDVEKCTKPCKDSAKKNSFKKLLNMKLSICFMKSDFQKFWSKSSQLGDTTT
GHLSSGEQKGIESDWQGLLVGEEKRSKPIKAYSTENYSLESQKKRKKSRGQTSAANGLRA
ESLDDQMLSRESSSQAPYKSVTSLCAPEYENIRHYEEIPEYENLPFIMAIQKTRELEWQN
SSSVEDTDANVYEVEEPYEAPDGQLQLGPRHQHSSSGASQEEQNHLGLGDLPSDEEEVIN
SSDEDDVSSESSKGEPDPLDYKQDEDNGMKSKVHHIAKEIMSSEKVFVDVLKLLHIDFRD
AVAHASRQLGKPVIEDRILNQILYYLPQLYELNRDLLKELEERMLHWTEQQRIADIFVKK
GPYLKMYSTYIKEFDKNIALLDEQCKKNPGFAAVVREFEMSPRCANLALKHYLLKPVQRI
PQYRLLLTDYLKNLIEDAGDYRDTQDALAVVIEVANHANDTMKQGDNFQKLMQIQYSLNG
HHEIVQPGRVFLKEGILMKLSRKVMQPRMFFLFNDALLYTTPVQSGMYKLNNMLSLAGMK
VRKPTQEAYQNELKIESVERSFILSASSATERDEWLEAISRAIEEYAKKRITFCPSRSLD
EADSENKEEVSPLGSKAPIWIPDTRATMCMICTSEFTLTWRRHHCRACGKIVCQACSSNK
YGLDYLKNQPARVCEHCFQELQKLDHQHSPRIGSPGNHKSPSSALSSVLHSIPSGRKQKK
IPAALKEVSANTEDSSMSGYLYRSKGNKKPWKHFWFVIKNKVLYTYAASEDVAALESQPL
LGFTVIQVKDENSESKVFQLRHKNMLFYLFKAEDAHSAQKWIEAFQEGTIL
Download sequence
Identical sequences A0A096MT41
ENSPANP00000002965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]