SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003037 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003037
Domain Number 1 Region: 163-405
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.16e-86
Family Eukaryotic proteases 0.00000000344
Further Details:      
 
Domain Number 2 Region: 51-157
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-16
Family Hepsin, N-terminal domain 0.00000157
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003037   Gene: ENSPANG00000024281   Transcript: ENSPANT00000017468
Sequence length 417
Comment pep:known_by_projection chromosome:PapAnu2.0:19:29568022:29595360:1 gene:ENSPANG00000024281 transcript:ENSPANT00000017468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKEGGRTVPCCSGPKVAALTAGTLLLLTAIGAASWAIVAVLLRSDQEPLYPVQVSSAD
ARLMVFDKTEGTWRLLCSSRSNTRIAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCV
DEGRLPHTQRLLEVISVCDCPRGRFLATVCQDCGRRKLPVDRIVGGRDTSLGRWPWQVSL
RYDGAHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVAQASPHGLQLGVQAVVYH
GGYLPFRDPNSEENSNDIALVHLSSPLPLTEYIQPVCLPAAGQALVDGKICTVTGWGNTQ
YYGQQAGVLQEARVPIISNDVCNGADFYGNQIKPKMFCAGYPEGGIDACQGDSGGPFVCE
DSISRTPRWRLCGIVSWGTGCALAQKPGVYTKVGDFREWIFQAIKTHSEASGMVTQL
Download sequence
Identical sequences A0A0A0MUQ9
ENSPANP00000003037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]