SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003917 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003917
Domain Number 1 Region: 365-585
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-53
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 725-787
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.0019
Further Details:      
 
Domain Number 3 Region: 585-708
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000616
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003917   Gene: ENSPANG00000017313   Transcript: ENSPANT00000006342
Sequence length 810
Comment pep:known_by_projection chromosome:PapAnu2.0:1:18651662:18667805:-1 gene:ENSPANG00000017313 transcript:ENSPANT00000006342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCGPPATLQPHLTGPPGTARCPVAVCQQESLSFAELPALKPPSPVCLNLFPVAPEELRA
PGSRWSLGTPAPLQGVLWPSSPGSSDTEIPGGGMRPSRAGSWPHCPGAQPPALEGPWSPQ
HTQPQRRASHGSEKKSAWRKMRVYQREEVPGCPEAHAVFLEPGQVVQEQAQSTEEPRPLE
LTGSTRVSLEGPERRRFSASELMTRLHSSLRLGRNSAARAPISGSGTGAAREGKASSRSV
ETTGPGVGTGCRDRVSRPAPGDSREGHGDWSEPRLDTQEEPPLGSRSTNERRQSRFLLNS
VLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLSPSSSFRAQRSARGSTF
SLWQDIPDVRGSGVLATLSLRDCKLQEAKFELITSEASYIHSLSVAVGHFLGSAELSECL
GAQDKQWLFSKLPEVKSTSERFLQDLEQRLEADVLRFSVCDVVLDHCPAFRRVYLPYVTN
QAYQERTYQRLLLENPRFPGILARLEESPVCQRLPLTSFLILPFQRITRLKMLVENILKR
TAQGSEDEDMATKAFNALKELVQECNASVQSMKRTEELIHLSKKIHFEGKIFPLISQARW
LVRHGELVELAPLPAAPPAKLKLSSKAVYLHLFNDCLLLSRRKELGKFAVFVHAKMAELQ
VRDLSLKLQGIPGHVFLLQLLHGQHMKHQFLLRARTESEKQRWISALCPSSPQEDKEVIS
EGEDRPQVQCVRTYKALQPDELTLEKTDILAVRTWTSDGWLEGVRLADGEKGWVPQAYVE
EISSLSARLRNLRENKRVTSATSKLGEAPV
Download sequence
Identical sequences A0A096MVN3
ENSPANP00000003917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]