SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003949 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003949
Domain Number 1 Region: 97-305
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-55
Family DBL homology domain (DH-domain) 0.0000399
Further Details:      
 
Domain Number 2 Region: 290-418
Classification Level Classification E-value
Superfamily PH domain-like 3.48e-25
Family Pleckstrin-homology domain (PH domain) 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003949   Gene: ENSPANG00000017788   Transcript: ENSPANT00000007815
Sequence length 1378
Comment pep:known_by_projection chromosome:PapAnu2.0:19:33689262:33703940:1 gene:ENSPANG00000017788 transcript:ENSPANT00000007815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGAQGLSLSKPSPSLGCGRRGEVCDCGTVCETRTAAPAAPTMTSPRGSGSSTSLSTVG
SEGDPAPGPTPACSVSRPEPLPGPPIRLHLSPVGIPGSAKPSRLERVAREIVETERAYVR
DLRSIVEDYLSPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLENSSSAGGIAECF
VQRSEDFDIYTLYCMNYPSSLALLRELSLSPPAALWLQERQAQLRHSLPLQSFLLKPVQR
ILKYHLLLQELGKHWAEGPGAGGREMVEEAIVSMTAVAWYINDMKRKQEHAARLQEVQRR
LGGWTGPELSAFGELVLEGAFRGGGGGGPRLRGGERLLFLFSRMLLVAKRRGLEYTYKGH
IFCCNLSVSESPRDPLGFKVSDLTIPKHRHLLQAKNQEEKRLWIHCLQRLFFENHPASIP
AKAKQVLLENSLHCAPKSKPVPEPLTPPLGSPRPRDARSFTPGRRNTAPSPGPSVIRRGR
RQSEPVKDPYVMFPQNAKHGFKHAGSEGELYPSESQPAVSGSGPPEDLEDAGPPTLDPSG
TSITEEILELLNQRGLRDPGPSTHDIPKFSGDSQVPGDSETLTFQALPSRDSLEMDERGP
SPLHVLEGLESSSAAEMPNIPCLTKIPDVPNLPEIPSHCEIPEGPLLPSLSDISGVFEMP
CLPAMPSVPDTPSLSSTPTLPCDSWLQGPLQEPVEAPATRRELFSGSNPGKLGESPSGGK
AGPEEDEEGVSFPDFQPQDVTQHQGFPDELAFRSCSEIRSAWQALEQGQLARPGFPEPLL
ILEDSDLGGDSGSGKAGAPSSERTASRVRELARLYSERIQQMQRAETRASANAPRRRPRV
LAQPQPSPCLPQEQVEPGLLPAFGHVLVCELAFPLTCAQESVPLGPAAWVQAAIPLSKQG
GSPDSQGLHVSNLPKQDHPGIHVSAATLLPEQGGSQHVQAPAATPLPKQECSLHFQVPAL
TTFPDPGHPETQVPATTPLPEHRSHVAIPAPSTAFCPEQGHCVDIHVPTTPALPKEICSD
FTVSATTPVPKQEGHLDSESSTNIPLTKQGGSRDVPGPDPVCSQPMPPLSLHGSSLDPQG
PGDTPPPLPCHLPDLQIPGTSPLPAHGSHLDHRIPAHAPLSLSQDLPDTRVPATTPLPLP
QGLTDIWVQALPTSPKQGSLPDIQGPAATPPLQEPSLTDTQVQKLTPLLEQKSLTDAHDP
AATPLPERGGSLDIPGLLPTPFQTTMVLSNPGGSLASHVARLESSDLTPPHSPPPSSRQL
LGPNAAALSRYLAASYISQSLARRQGPGGGAPTASRGSWSASAPTSRASSPPPQPQPPPP
PARRLSYATTVNIHVGGGGRLRPAKAQVRLNHPALLASTQESMGLRRAQGAPDARFHM
Download sequence
Identical sequences ENSPANP00000003949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]