SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000003996 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000003996
Domain Number 1 Region: 410-798
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.34e-131
Family Ankyrin repeat 0.000000000348
Further Details:      
 
Domain Number 2 Region: 165-428
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.49e-74
Family Ankyrin repeat 0.000003
Further Details:      
 
Domain Number 3 Region: 13-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 6e-56
Family Ankyrin repeat 0.0000175
Further Details:      
 
Domain Number 4 Region: 1426-1536
Classification Level Classification E-value
Superfamily DEATH domain 1.12e-25
Family DEATH domain, DD 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000003996   Gene: ENSPANG00000007604   Transcript: ENSPANT00000028549
Sequence length 1878
Comment pep:known_by_projection chromosome:PapAnu2.0:5:104202371:104468845:1 gene:ENSPANG00000007604 transcript:ENSPANT00000028549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKRKSDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQE
LLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENH
IDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARK
DDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFT
ARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERG
APLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTK
LLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMG
HLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLH
IASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKK
GFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASP
HATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLL
DKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVK
MVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAK
RLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEEGDDTMTGDGGEYL
RPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSDSLRSFSSDRSHTLSHASYLRDSAVM
DDSVVIPSHQVSTLAKEAERNSYRLSWGTENLDNVALSSSPIHSGFLVSFMVDARGGAMR
GCRHNGLRIIIPPRKCTAPTRVTCRLVKRHRLATMPPMVEGEGLASRLIEVGPSGAQFLG
PVIVEIPHFAALRGKERELVVLRSENGDSWKEHFCDYTEDELNEILNGMDEVLDSPEDLE
KKRICRIITRDFPQYFAVVSRIKQDSNLIGPEGGVLSSTVVPQVQAVFPEGALTKRIRVG
LQAQPMHTELVKKILGNKATFSPIVTLEPRRRKFHKPITMTIPVPKASSDVMLNGFGGDA
PTLRLLCSITGGTTPAQWEDITGTTPLTFVNECVSFTTNVSARFWLIDCRQIQESVTFAS
QVYREIICVPYMAKFVVFAKSHDPIEARLRCFCMTDDKVDKTLEQQENFAEVARSRDVEV
LEGKPIYVDCFGNLVPLTKSGQHHIFSFFAFKENRLPLFVKVRDTTQEPCGRLSFMKEPK
STRGLVHQAICNLNITLPIYTKESESDQEQEEEIDMTSEKNPQDEQERIEERLAYIADHL
GFSWTELARELDFTEEQIHQIRIENPNSLQDQSHALLKYWLERDGKHATDTNLIECLTKI
NRMDIVHLMETNIEPLQERISHSYAEIEQTITLDHSEGFSVLQEELCTARHKQKEEQALS
KESETCDHPPIVSEEDISVGYSTFQDGIPKTEGDSSASALFPQTHKEQVQQDFSGKMQDL
PEESSLEYRQEYFVTTPGTEASETQKATTVPGSPSKTPEEVSTPPEEDRLYLQTPTSSER
GGSPIIQEPEEPSEHREESSPRKTSLVIVESADNQPETHERLDEDAAFEKGDDMPEIPPE
TVTEEEYIDEHGHTVVKKVTRKIIRRYVSSEGTEKEEITVQGMPQEPVNIEEGDGYSKVI
KRVVLKSDTEQSEVTLCEPSILSSTSQFQAEPVEGRRVSKVVKTTVVRGERMEKHLGDSS
LATDLPSAKDDFEEDNNE
Download sequence
Identical sequences ENSPANP00000003996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]