SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004009 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004009
Domain Number 1 Region: 1155-1376
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-54
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 1366-1524
Classification Level Classification E-value
Superfamily PH domain-like 3.61e-19
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 
Domain Number 3 Region: 1509-1574
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004009   Gene: ENSPANG00000016463   Transcript: ENSPANT00000002577
Sequence length 1597
Comment pep:known_by_projection chromosome:PapAnu2.0:3:165960069:165978735:1 gene:ENSPANG00000016463 transcript:ENSPANT00000002577 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEAQHGASPPIPAIVELSIIPEASMRSSQVSALGLEAQEDEDPSYKWREEYRLSATQ
QRELRDVCDYAGEMMPSFPKEGSADVEPNQESLVAETCDTPEHWEAAPQSLAGRQARTVA
SPELWACPIQSDHLDMASFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDTSGQT
RFYSPCEEHPAETNQSEGSESETIRQGEELPSEELQESRGLLHPQEVQVLEEQGQQEAGF
AGEGTLGEDVCADGLLGEEQMIQQVNREKGEQKQKQEQVQDDVMLGRQGERARLTGEPEG
LNDGEWEQEDMERRAQGQGGPEQGEGRKRELQMPEENRVDSQDEKSQSFVGKSEEVTGKQ
EDHGLKEKGVPVSGQEEKEPGSWDGGRLGAVGGVRSREEENEHHGPSMPALVAPEDSPHC
DVFPGASYLVTQIPRTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFSTEESPDKEI
AQNSQQEGSRLRKGTVSSQGTKAVFASASVTPPGTPDSAPPSPAEASPITPASVSARPPG
AFPRREISCAAHASETASAPLSMDDPSPRGTSEMCPATLHGFPSAGASPPRPPANSTGTV
QYLRSDSFPGSHRTEQTPDLVGMLLFHSHSELPQRPPKPAIYSSVTPRRDRNSGRNCSTV
SESPTALSTPKQDSQGSISNLERPSSPPSSQSWGSPHNPAFAAESPAYGSSPSFVSMDVR
IHEPLPPPPPERRDAHPSVVERDGHPRVVVPTLKQHSHPPPLALGSGPYTPHKGPLPQAS
DPAVARQHRPLPSTPDSFHHAQVTPRWRYNKPLPPTPDLPQPHLSSISAPGISRIYRPLP
PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPAGQDWTVPIPTSAGRTSWPP
ATGRSTESFTSSSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGSTPKDEAGVSEHP
EVPAREPLRRTTPQQGTSGPGRSSVSQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
QAVAPSEGASKHKGWSRQGLRRPSILPEGSSDSRGPAMEKHLAPSDTVVFREKKPKEVMG
GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLPETPGPSSPRQPRKALVSSESY
LKRLSVASSGSLWQEIPMVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFLSDLEENFENNIFSFQVCDVVLNHAPDF
RRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITRL
KLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRQTEELIYLSQKIEFECK
IFPLISQSRWLVKSGELTALEFSVSPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLVF
DHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQSTQGAQAEFLFSTETQSEKLRWISALAMP
REELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGW
FPVQQVEFISNPEVRARNLKEAHRVKTAKLQLVEQQA
Download sequence
Identical sequences A0A096MVW8
ENSPANP00000004009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]