SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004074 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004074
Domain Number 1 Region: 1044-1256
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-52
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 1722-1962
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000137
Family WD40-repeat 0.013
Further Details:      
 
Domain Number 3 Region: 1248-1344
Classification Level Classification E-value
Superfamily PH domain-like 0.000000225
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004074   Gene: ENSPANG00000000122   Transcript: ENSPANT00000018700
Sequence length 2047
Comment pep:known_by_projection chromosome:PapAnu2.0:14:63132027:63191205:1 gene:ENSPANG00000000122 transcript:ENSPANT00000018700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGAPRPPLYRSVSFKLLERWSGGPGPREEDTDTPGLRRRASCRPTTAALGQPSRRVSK
LASGPPAAPAQPRPLRSLSRRCANSPGASNAPRLDYGSAGARDGGVFPAAAEEAAEGPAR
GAWPSVTEMRKLFGGPGSRRPSADSESPGTPSPDGAAWEPPARESRQPPTPPPRTCFPLV
GLRSARPLTGPGIEGRLRQQERALRPADGLHSWHIFSQPQAGARRVSRSRAASSSEEEEE
GPPQPPGAQSPAYHGGHSSGSDDDRDGEGGHRWGGRPRLRPGSSLLDQDCRPDSDGLNLS
SMDSAGGARSPEPPASPRAPGEEGLREWGSGSPPCVPGPQEGLRPMSDSVGGALRVAKVS
FPSYLASPAGSCGSSRYSSTETLKDDDLWSSRGSGGWGVYRSPSFGAGEGLLRSQARTRA
KGPGGTSRALRDGGFEPEKSRQRKSLSNPDIASETLTLLSFLRSDLSELRVRKPGGSPGD
RVSSPLDGRDSPSAGGSMGQLEPVSIPAPASPGTRPTLKDLTATLRRAKSFTCSEKPMAR
RLPRTSALKPSSSELLLAGPSAEEDPLPLIVQDQYVQEARQVFEKIQRMGAQQDDGSDAP
PESPDWAQDVTRGQRSQEELSGPESSLTDEGIGADPEPPVAVFCGLGTTGMWRPLSSSSA
QTNHRSPGTEDSLGGWALVSPEIPSTPGALRRRRKVPPSGSGGSELSNGEAGEAYRSLSD
PIPQRHRAATSEEPTGFSVDSNLLGSLSPKTGLPATSAMDEGLTSGHSDWSVGSEESKGY
QEVIQSIVQGPGTLGRVVDDRVAGKAPKKKSLSDPSRRGELAGPGFQGPGGEPIREVEPV
LPPSSSEPILVEQRAEPEEPGAARSRAQSERALPEALPPPATAHQNFHLDPKLADILSPR
LIRRGSKKRPARSSHQELGRDEGSQDQIGGLSRARPSSKHVRHASVPATFMPIVVPEPPT
SVGPPVAVPEPIGFPARAHPTLQAPSLEDVTKQYMLNLHSGEVPAPVPVDMPCLPLAALP
SAETKPPEAARPPDEPAPASKCCSKPQVDMRKHVAMTLLDTEQSYVESLRTLMQGYMQPL
KQPENSVLCDPALVDEIFDQIPELLEHHEQFLEQVRHCVHTWHAQQKVGALLVQSFSKDV
LVNIYSAYIDNFLNAKDAVRVAKEARPAFLKFLEQSMRENKEKQALSDLMIKPVQRIPRY
ELLVKDLLKHTPEDHPDHPLLLEAQRNIKQVAERINKGVRSAEEAERHARVLQEIEAHIE
GMEDLQAPLRRFLRQEMVVEVKAISGKKDRSLFLFTDLIVCTTLKRKSGSLRRSSMSLYT
AASVIDTASKYKMLWKLPLEDTDIIKGASQATNRENIQKAISRLDEDLTTLGQMSKLSES
LGFPHQSLDDALRDLSAAMHRDLSEKQALCYALSFPPTKLELCTTRPEGTDSYIFEFPHP
DARLGFEQAFDEAKRKLASTKSCLDPEFLKAIPIMKTRSGMQFSCAAPTLNSCPEPSPEV
WVCNSDGYVGQVCLLSLRAEPDVEACIAVCSARILCIGAVPGLQRRCHREPPPSLRSPSE
TAPEPAGPELDVEAAADEEAATLAEPGPQPCLHISIAGSGLEMTPGLPEGDPRPELVPFD
SDSDDESSPSPSGTLQSQASRSTISSSFGNEETPSSKEATAETTSSEEEQEPGFLPLSGS
FGPGGPCSTSPMDGRALRRSSRGSFTRGSLEDLLSVDPEAYQSSVWLGTEDGCVHVYQSS
DSIRDRRNSMKLQHAASVTCILYLNNQVFVSLANGDLVVYQREAGHFWDPQNFKSVTLGA
QGSPITKMVSVGRRLWCGCQNRVLVLSPDTLQLEHTFYVGQDSSRSVACMVDSSLGVWVT
LKGSAHVCLYHPDTFEQLAEVDVTPPVHRMLAGSDAIIRQHKAACLRITALLVCEELLWV
GTSAGVVLTMPTSPSTVSCPRAPLSPTGLGQGHTGHVRFLATVQLPDGFNLLCPTPPPAP
DTGPEKLPSLEHRDSPRHRGPASARPKMLVISGGDGYEDFRLSSGGGSSSETVGRDDSTN
HLLLWRV
Download sequence
Identical sequences ENSPANP00000004074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]