SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004885 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004885
Domain Number 1 Region: 1155-1377
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-50
Family DBL homology domain (DH-domain) 0.00029
Further Details:      
 
Domain Number 2 Region: 1367-1525
Classification Level Classification E-value
Superfamily PH domain-like 3.61e-19
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 
Domain Number 3 Region: 1510-1575
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-16
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004885   Gene: ENSPANG00000016463   Transcript: ENSPANT00000024641
Sequence length 1598
Comment pep:known_by_projection chromosome:PapAnu2.0:3:165960069:165978735:1 gene:ENSPANG00000016463 transcript:ENSPANT00000024641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAEEAQHGASPPIPAIVELSIIPEASMRSSQVSALGLEAQEDEDPSYKWREEYRLSATQ
QRELRDVCDYAGEMMPSFPKEGSADVEPNQESLVAETCDTPEHWEAAPQSLAGRQARTVA
SPELWACPIQSDHLDMASFSSDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDTSGQT
RFYSPCEEHPAETNQSEGSESETIRQGEELPSEELQESRGLLHPQEVQVLEEQGQQEAGF
AGEGTLGEDVCADGLLGEEQMIQQVNREKGEQKQKQEQVQDDVMLGRQGERARLTGEPEG
LNDGEWEQEDMERRAQGQGGPEQGEGRKRELQMPEENRVDSQDEKSQSFVGKSEEVTGKQ
EDHGLKEKGVPVSGQEEKEPGSWDGGRLGAVGGVRSREEENEHHGPSMPALVAPEDSPHC
DVFPGASYLVTQIPRTQTESRAEELSPAALSPSLEPIRCSHQPISLLGSFSTEESPDKEI
AQNSQQEGSRLRKGTVSSQGTKAVFASASVTPPGTPDSAPPSPAEASPITPASVSARPPG
AFPRREISCAAHASETASAPLSMDDPSPRGTSEMCPATLHGFPSAGASPPRPPANSTGTV
QYLRSDSFPGSHRTEQTPDLVGMLLFHSHSELPQRPPKPAIYSSVTPRRDRNSGRNCSTV
SESPTALSTPKQDSQGSISNLERPSSPPSSQSWGSPHNPAFAAESPAYGSSPSFVSMDVR
IHEPLPPPPPERRDAHPSVVERDGHPRVVVPTLKQHSHPPPLALGSGPYTPHKGPLPQAS
DPAVARQHRPLPSTPDSFHHAQVTPRWRYNKPLPPTPDLPQPHLSSISAPGISRIYRPLP
PLPIIDPPTEPPPLPPKSRGRSRSTRGGHMNSGGHAKTRPAGQDWTVPIPTSAGRTSWPP
ATGRSTESFTSSSRSKSEVSPGMAFSNMTNFLCPSSPTTPWTPELQGSTPKDEAGVSEHP
EVPAREPLRRTTPQQGTSGPGRSSVSQARQPEKPSHLHLEKASSWPHRRDSGRPPGDSSG
QAVAPSEGASKHKGWSRQGLRRPSILPEGSSDSRGPAMEKHLAPSDTVVFREKKPKEVMG
GFSRRCSKLINSSQLLYQEYSDVVLNKEIQSQQRLESLPETPGPSSPRQPRKALVSSESY
LKRLSVASSGSLWQEIPMVRNSTVLLSMTHEDQKLQEVKFELIVSEASYLRSLNIAVDHF
QLSTSLRATLSNQEHQWLFSRLQDVRDVSATFFPPLETLSFSYEIFSFQVCDVVLNHAPD
FRRVYLPYVTNQTYQERTFQSLMNSNSNFREVLEKLESDPVCQRLSLKSFLILPFQRITR
LKLLLQNILKRTQPGSSEEAEATKAHHALEQLIRDCNNNVQSMRQTEELIYLSQKIEFEC
KIFPLISQSRWLVKSGELTALEFSVSPGLRRKLNTRPVHLHLFNDCLLLSRPREGSRFLV
FDHAPFSSIRGEKCEMKLHGPHKNLFRLFLRQSTQGAQAEFLFSTETQSEKLRWISALAM
PREELDLLECYDSPQVQCLRAYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERG
WFPVQQVEFISNPEVRARNLKEAHRVKTAKLQLVEQQA
Download sequence
Identical sequences ENSPANP00000004885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]