SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000004903 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000004903
Domain Number 1 Region: 197-444
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-88
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 101-204
Classification Level Classification E-value
Superfamily SRCR-like 4.97e-19
Family Hepsin, N-terminal domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000004903   Gene: ENSPANG00000007319   Transcript: ENSPANT00000008035
Sequence length 448
Comment pep:known_by_projection chromosome:PapAnu2.0:14:103136505:103148282:-1 gene:ENSPANG00000007319 transcript:ENSPANT00000008035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGWGQWRAIILHFLDPPWGQPHMIDVSQVVCWRSMRRGCAVLGALGLLASVGVGSWLLV
LYLCPAASQPISGTLQDEEITLSCSEAGGEEALLPALPKTVSFRINSEDFLLEVQVRDRP
RWLLVCHEGWSPALGLQVCWSLGYLRLTHHKGVNLTDIKLNSSQEFAQLSPRLEGFLEEV
WQPRNNCTSGRVVSLRCSECGARPLASRIVGGQAVAPGRWPWQASVALGFRHTCGGSVLA
PHWVVTAAHCMHSFRLSHLSSWRVHAGLVSHSAVRPHQGAVVERIIPHPLYSAQNHDYDV
ALLRLRTPLNFSDTVGAVCLPAKEQHFPKGSQCWVSGWGHTDSSHTYSSDMLQDTVVPLL
STQLCNSSCVYSGALTPRMLCAGYLDGRADACQGDSGGPLVCPDGDTWRLVGVVSWGLGC
AEPNHPGVYAKVAEFLDWIHDTVQDSLL
Download sequence
Identical sequences A0A096MY98
ENSPANP00000004903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]