SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005120 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005120
Domain Number 1 Region: 538-749
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-45
Family DBL homology domain (DH-domain) 0.00031
Further Details:      
 
Domain Number 2 Region: 223-367
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-42
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 3 Region: 875-1027
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 4 Region: 123-225
Classification Level Classification E-value
Superfamily Second domain of FERM 1.13e-27
Family Second domain of FERM 0.00011
Further Details:      
 
Domain Number 5 Region: 735-859
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-27
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 6 Region: 42-122
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.61e-23
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005120   Gene: ENSPANG00000023227   Transcript: ENSPANT00000013949
Sequence length 1044
Comment pep:known_by_projection chromosome:PapAnu2.0:17:75479864:75781262:1 gene:ENSPANG00000023227 transcript:ENSPANT00000013949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRA
PGKVLLDAVCNHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFF
PPDHTQLQEELTRYLFALQVKQDLAQGRLTCNDSSAALLISHIVQSEIGDFDEALDREHL
AKNKYIPQQDALEDKIVEFHHNHIGQTPAESDFQLLEIARRLEMYGIRLHPAKDREGTKI
NLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKLRPDANSAYQDTLEFLMASRD
FCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDYVKEGGHKKVQ
FERKHSKIHSVRSLASQPTELNSEVLEQSQQSASLTFGEGAESPGGQSCQQGKEPKVSPG
EPGSRPSPAPRSPAGNKQVDGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLS
ELSVNSQGGVAPAHVTLSPNLSPDTKQTSPLISPLLNDQACPRTDDEDEGRRKRFPTDKA
YFIAKEVSTTERTYLKDLEVITSWFQSTVSKEDAMPETLKSLIFPNFEPLHKFHTNFLKE
VEQRLALWEGRSNAQIRDYQRIGDVMLKNIQGMKHLAAHLWKHSEALEALENGIKSSRRL
ENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLCKHHPPSHADFRDCRAALAEIT
EMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLSGKGLQQRMFFL
FNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASSR
SEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSLE
RQAPHRGNTMVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCL
FFYKSHQDNHPLASLPLLGYSLTIPSESENIHKDYVFKLHFKSHVYYFRAESEYTFERWM
EVIRSATSSASRAHVLSHKESLVY
Download sequence
Identical sequences A0A096MYU4
ENSPANP00000005120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]