SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005411 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005411
Domain Number 1 Region: 1265-1444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-52
Family DBL homology domain (DH-domain) 0.0000000134
Further Details:      
 
Domain Number 2 Region: 1899-2096
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-51
Family DBL homology domain (DH-domain) 0.0000212
Further Details:      
 
Domain Number 3 Region: 2714-2950
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.11e-47
Family Protein kinases, catalytic subunit 0.0000136
Further Details:      
 
Domain Number 4 Region: 1451-1571
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 5 Region: 2097-2214
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-31
Family Pleckstrin-homology domain (PH domain) 0.00062
Further Details:      
 
Domain Number 6 Region: 2484-2645
Classification Level Classification E-value
Superfamily Fibronectin type III 5.08e-24
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 7 Region: 263-399
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-18
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 8 Region: 1083-1220
Classification Level Classification E-value
Superfamily Spectrin repeat 6.99e-18
Family Spectrin repeat 0.0069
Further Details:      
 
Domain Number 9 Region: 485-626
Classification Level Classification E-value
Superfamily Spectrin repeat 2.37e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 10 Region: 827-986
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000536
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 11 Region: 2304-2367
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000818
Family SH3-domain 0.0000302
Further Details:      
 
Domain Number 12 Region: 1619-1696
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000719
Family SH3-domain 0.0028
Further Details:      
 
Domain Number 13 Region: 20-166
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 14 Region: 176-294
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 15 Region: 631-751
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000072
Family Spectrin repeat 0.0041
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005411
Domain Number - Region: 404-517
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0846
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005411   Gene: ENSPANG00000006705   Transcript: ENSPANT00000016766
Sequence length 2978
Comment pep:known_by_projection chromosome:PapAnu2.0:2:43728267:44227385:1 gene:ENSPANG00000006705 transcript:ENSPANT00000016766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVCFPTGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTFPARSNHDRIRQEDLR
KLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFPAEIHVALIIKPDNFW
QKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNHEEWIELRLSLEEFFN
SAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKAPVEELDREGQRLLQC
IRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWHVRKLKLDQCFQLRLF
EQDAEKMFDWISHNKELFLQSHTEIGVSYQYALDLQTQHNHFAMNSMNAYVNINRIMSVA
SRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVFHQKAEQFLSGVDAWC
KMCSEGGLPSEMQDLELAIHHHQTLYEQVTQAYTEVSQDGKALLDVLQRPLSPGNSESLT
ATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENH
GEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEI
YKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDLQKEMLEDVCADSVDA
VQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSEARDSAVSNNKTPHGS
SISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLLRQ
MNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIMEVQASGIELICEKDI
DLAAQVQELLEFLHEKQHELELNAEQTHKRLEQCLQLRHLQAEVKQVLGWIRNGESMLNA
SLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQQKAEVLLQAGHYDAD
AIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLESLEQEYRRDEDWCGG
RDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYIHRNNVSMPSVASHTR
GPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAKQALDWIQETGEFYLS
THTSTGETTEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVEKGHIHATEIRKWVTT
VDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDREVKLRDANHEVNEEK
RKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPPGILNKEHIIFGNIQE
IYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKPDSNQLILEHAGTFFD
EIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELKDGLEVMLSVPKKAND
AMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFLFEISLVFSKEIKDSS
GHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVLKASNIETKQEWIKNI
REVIQERIIHLKGALKEPLQLPKTPAKQRNNSKSRDGVEDIDSQGDGSSQPDTISIASRT
SQNTVDSDKLSGGCELTVVLQDFSAGHSSELTIQVGQTVELLERPSERPGWCLVRTTERK
GLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSSENGGKSESVANLQAQPSLNSIHSSP
GPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFDLGSPKPGDETTPQGDSA
DEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMSSSLLAARQASTEVPTAADLVSA
IEKLVKNKLSLEGGSYRGSLKDPAGCLNEGMAPPTPPRNPEEEQKAKALRGRMFVLNELV
QTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQIYDWHKDFFLAELEKCI
QEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVAEYDTYFEEVKQEINQRLTLSDFLIK
PIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRCNDMMNLGRLQGFEGTLT
AQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLRKGSLTPGYMFKRSIKMN
YLVLEENVDNDPCKFALMNRETSERVILQAANADIQQAWVQDINQVLETQRDFLNALQSP
IEYQRKERSTAVMRSQPARLPQASPRPYSSVPVGSEKPPKGSSYNPPLPPLKISTSNGSP
GFEYHQSGDKFEASKQNDLGGCNGTSSMAVIKDYYALKENEICVSQGEVVQVLAVNQQNM
CLVYQPASDHSPAAEGWVPGSILAPLTKATAAESSDGSIKKSCSWHTLRMRKRAEVENTG
KNEATGSRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEILNPNFIQEVAPEFLVPLV
DVTCLLGDTVVLQCKVCGRPKPTITWKGPDQNILDTDNSSATYTVSSCDSGEITLKICNL
MPQDSGIYTCIATNDHGTTSTSATVKVQGVPAAPNRPIAQERSCTSVILRWLPPSSTGNC
TISGYTVEYREEGSQIWQQSVASTLDTYLVIEDLSPGCPYQFRVSASNPWGISLPSEPSE
FVRLPEYEDAAADGATISWKENFDSAYTELNEIGSSKYMMGKKKYVFCLEKKTELPLMVK
MAEKNIGVNEGECFLNKVIHISSPQYTILMCYFSISSYQTYFLCLSLPTFRMDDGRLLDY
LMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVKLIDLEDA
VQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFLDESKEET
CINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPHNGSYSKI
PLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
Download sequence
Identical sequences ENSPANP00000005411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]