SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005559 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005559
Domain Number 1 Region: 598-787
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-53
Family DBL homology domain (DH-domain) 0.00000000761
Further Details:      
 
Domain Number 2 Region: 792-932
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-39
Family Pleckstrin-homology domain (PH domain) 0.000000125
Further Details:      
 
Domain Number 3 Region: 290-428
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1088-1143
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000289
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 5 Region: 45-199
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000536
Family CRAL/TRIO domain 0.0097
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000005559
Domain Number - Region: 434-529
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0307
Family Spectrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005559   Gene: ENSPANG00000010991   Transcript: ENSPANT00000004557
Sequence length 1185
Comment pep:known_by_projection chromosome:PapAnu2.0:17:89715626:89823640:1 gene:ENSPANG00000010991 transcript:ENSPANT00000004557 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKGASRGTLRRLWSLPRRRRGTAGRSRPDEIMHQDIVPLCAADIQDQLKKRFAYLSGG
RGQDGSPVITFPDYPAFSEIPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRRDKWTSVK
ASVLRIAASFPANLQLVLVLRPTGFFQRTLSDIAFKFNRDDFKMKVPVIMLSSVPDLHGY
IDKSQLTEDLGGTLDYCHSRWLCQRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQS
TSSVLCAHTEKKDKAKEDLRLALKEGHSVLESLGELQAEGSEPGVNQDQLDNQATVQRLL
AQLNETEAAFDEFWAKHQQKLEQCLQLRHFEQGFREVKAVLDAVCQKIATFTDIGNSLAH
VEHLLRDLASFEEKSGVSVERARALSLDGEQLIENKHYAVDSIRPKCQELRHLCDQFSAE
IVRRRGLLGKSLELHRRLETSLKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETS
AENKIQELNTIYKEYESILNQDLMEHVRKVFQKQASMEEVFHRRQASLKKLAARQTRPVQ
PVAPRPEALAKSPCPSPGIRRGSENSSSEGGALRRGPYRRAKSEMSESRQGRSSAGEEEE
SLAILRRHVMSELLDTERAYVEELLCVLEGYASEMDNPLMAHLLSTGLHSKKDVLFGNME
EIYHFHNRIFLRELENYTDCPELVGRCFLERMEDFQIYEKYCQNKPRSESLWRQCSDCPF
FQECQRKLDHKLSLDSYLLKPVQRITKYQLLLKEMLKYSKNCEGAEDLQEALSSILGILK
AVNDSMHLIAITGYDGNLGDLGKLLMQGSFSVWTDHKRGHTKVKELARFKPMQRHLFLHE
KAVLFCKKREENGEGYEKAPSYSYKQSLNMAAVGITENVKGDAKKFEIWYNAREEVYIVQ
APTPEIKAAWVNEIRKVLTSQLQACREASQHRALEQSQSLPLPAPTSTSPSRGNSRNLKK
LEERKTDPLSLEGYVSSAPLPKPPEKGKDDTVTSSASESSALSRKRFTLQGFANLKGQKA
SPTSPDKKAKRHEVKSDPTPFGLRGWSKTSHSLEAPEDDGGWSSAEEQVNSSDAEEDGGL
GLKKLVPGKYTVVADHEKGGPDALVVRSGDVVELVQQGDEGLWYVRDPTTGKEGWVPASS
LSVQLGPSGSAQCLSSSESSPGSAVLSNSSSCSEGGQAPFSDLQG
Download sequence
Identical sequences ENSPANP00000005559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]