SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005653 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005653
Domain Number 1 Region: 403-639
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-55
Family DBL homology domain (DH-domain) 0.0000401
Further Details:      
 
Domain Number 2 Region: 639-760
Classification Level Classification E-value
Superfamily PH domain-like 1.94e-31
Family Pleckstrin-homology domain (PH domain) 0.00064
Further Details:      
 
Domain Number 3 Region: 217-279
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000135
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005653   Gene: ENSPANG00000006851   Transcript: ENSPANT00000010176
Sequence length 1174
Comment pep:known_by_projection chromosome:PapAnu2.0:1:129814255:129866854:-1 gene:ENSPANG00000006851 transcript:ENSPANT00000010176 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRAVPDVFLAGGDQVPRGHTRRCLSAVESREQLEEEEAGEIKEGNGSHAVPLRRSGAFR
AHGRNYDVFKRHSWGPGRELEDPLTRRRLGASGCPGPEEAPYLQNQEELDTFLGLQHQGG
YPSRLGQDSCHPSAGPLDHSATGMLSKSVSMSGINCLLDWSDPDGNLSQSSAIDLRKRCS
QLEGHSGTWAGSSLRRTFSFLLGMTGKAKTREKEKMKEAKDARYTNGHLFTTISVSGMTM
CYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRS
KTTIRERPSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILS
QSTDSLNMRNRTLSVESLIDEAEVIYNELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKE
VMKQQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTR
FLSQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMRKTYSEFCSRHTKALKLY
KELYARDKRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLISRILQHSHGIEEER
QDLTTALGLVKELLSNVDQDIYELEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRK
LIHDGCLLWKTATGRFKDVLMLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIA
NQEKGMFLISAAPPEMYEVHTASRDDRSTWIRVIQQSVRICPSREDFPLIETEDEAYLRR
IKMELQQKDRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGE
RLLQDAIREVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSI
ELCRADSDSSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPE
RREKLCRANSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEA
GSLEARLRESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDA
LYLSFNPPQPNRGTDRLDLPVTTRSVHRHFEDRERQELGSPEERLQDSSDPDTGSEEEGS
SRLSPPHSPRDFTRMQDIPEETESRDGEAVASES
Download sequence
Identical sequences ENSPANP00000005653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]