SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005675 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005675
Domain Number 1 Region: 2-526
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 2.22e-76
Family Acetyl-CoA synthetase-like 0.0000345
Further Details:      
 
Domain Number 2 Region: 708-1050
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 2.88e-49
Family Quinoprotein alcohol dehydrogenase-like 0.011
Further Details:      
 
Domain Number 3 Region: 538-593
Classification Level Classification E-value
Superfamily ACP-like 0.0000471
Family Acyl-carrier protein (ACP) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005675   Gene: ENSPANG00000018913   Transcript: ENSPANT00000009177
Sequence length 1052
Comment pep:known_by_projection chromosome:PapAnu2.0:5:72145027:72184308:1 gene:ENSPANG00000018913 transcript:ENSPANT00000009177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVRKAASCYMDKVAVCFDECNNQLPVYYTYKTVVNAASELSNFLLLHCDFQGIRE
IGLYCQPGIDLPSWILGILQVPAAYVPIDTDSPPSLSTHFMKKCNLKYILVRLKRLRKFK
SFHETLLSYDTFTVEHNDLVLFRLHWKNTEVNLMLSDISISSEHVNEEKAEHVDLRLKHC
LAYVLHTSGTTGIPKIVRVPHECIVPNIQHFQVLFDITQEDVLFLASPLTFDPSVVEIFL
ALSSGASLLIIPTSIKLLPSKLASVLFSHHRVTVLQATPTLLRRFGSKLIKSNVLSATTS
LRVLALGGEAFPSLTVLRSWRGEGNKTQIFNVYGITEVSSWATIYRIPEKILNSTLKCEL
PVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGRNRVCFLDDEVTVPLGTMRATGDFVT
VKDGVGRKDSQIKRHGKRLNIELVQQVAEELQQVESCAVTWYNQEKLILFMVSKDASVKE
YIFKELHKYLPSHAIPDELVLIDSLPFTSHGKIDVSELNKIYLNYINLKSENKLSGKEDL
WEKLQYLWKSTLNLPEDLLKVPDESLFLNSGGDSLKSVRLLSEIEKLVGTSVPGLLEIIL
SSSILEIYNHILQTVFPDEDVTFRKSCATKRKLSDINQEEILSLNTTRFSTKLGHCSSAY
PSDSVSQTNIQNVKDLNSPVLIGKSKDPSCVVKVSEEGKPAIGTQKMELHVRWRSDTGKC
VDASPLVVIPAFDKSSTTVYIGSHSHRMKAVDFYSGKVKWEQLLGDRIESSACVSKCGNF
IVVGCYNGLVYVLKSNSGEKYWMFTTGDAVKSSAAMDPTTGLIYIGSHDQHAYALDIYRK
KCVWKSKCGGTVFSSPCLNPIPHNLYFATLGGLLLAVNPATGNIIWKHSCGKPLFSSPRC
CSQYVCIGCVDGNLLCFTHFGEQVWQFCTSGPIFSSPCTSSSEQKIFFGSHDCFVYCCNM
KGHLQWKFETTSRVYATPFAFHNCNSSNEMLLAAASTDGKLWILESQSGQLQSVYELPGE
VFSSPVVLESMLIIGCRDNYVYCLDLLGGNKK
Download sequence
Identical sequences ENSPANP00000005675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]