SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005822 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005822
Domain Number 1 Region: 269-507
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-40
Family Kelch motif 0.0013
Further Details:      
 
Domain Number 2 Region: 10-128
Classification Level Classification E-value
Superfamily POZ domain 5.49e-33
Family BTB/POZ domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005822   Gene: ENSPANG00000008194   Transcript: ENSPANT00000001679
Sequence length 526
Comment pep:known_by_projection chromosome:PapAnu2.0:12:99936691:99952577:1 gene:ENSPANG00000008194 transcript:ENSPANT00000001679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRNVDDLDFHLPSHAQDMLEGLQRLRSQPKLADVTLLVGGRELPCHRGLLALSSPYFHA
MFAGDFAESFSARVELRDVEPAVVGQLVDFVYTGRLTITQGNVEALTRTAARLHFPSVQK
VCGRYLQQQLDAANCLGICEFGEQQGLLGVAAKAWAFLRENFEAVAREDEFLQLPRDRLV
TCLASDLLQVQPEQSRLEALLRWVRHDPQARASHLPELLSLVHLDAVPRPCVQQLLATEP
LIQESEACRAALSQGRDGAPLALRQKLEEVLVVVGGRALEEDEAGEEPTPRLGNFAFYNS
KAKRWMALPDFPDYHKWGFSLAALNNNIYVTGTTLDVVEVESYDPYTDSWTPISPALKYV
SNFSAAGCRGRLYLVGSSACKYNALALQCYNPVTDAWSVIASPFLPKYLSSPRCAALHGE
LYLIGDNTKKVYVYDPGANLWQKVQSQHSLHENGALVPLGDALYVTGGRWQGMEGDYHVE
MEAYDTVRDTWTRHGALPRLWLYHGASTVFLDVSKWTQPFSSTQEH
Download sequence
Identical sequences A0A096N0N4
ENSPANP00000005822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]