SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000005935 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000005935
Domain Number 1 Region: 152-373
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-49
Family DBL homology domain (DH-domain) 0.00037
Further Details:      
 
Domain Number 2 Region: 376-507
Classification Level Classification E-value
Superfamily PH domain-like 7.15e-23
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000005935   Gene: ENSPANG00000010167   Transcript: ENSPANT00000010329
Sequence length 788
Comment pep:known_by_projection chromosome:PapAnu2.0:11:6401004:6416384:1 gene:ENSPANG00000010167 transcript:ENSPANT00000010329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAFGPPNEGPLQGLVASRIETYGGRHRASAQSTAGSLYPRGGLVLDPSRRRLQQYVPFV
RGSGQSRGLSPMRLRDPEPEKRHGGHVGAGLPHSPKLKEVTKAHELEVRLHTFSMFGMPR
LPPEDRRHWEIGEGSDSALAIEKSWRELVPGHKEMSRELCHQQEALWELLTTELIYVRKL
KIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPSLIRTHRSFWEEVLGPTLEETRASGQP
LDPIGLESGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQ
MLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQ
ESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKE
GREGKLDVYLFLFSDVLLVTKPQRKVDKAKVIRPPLMLEKLVCQPLRDPHSFLLIHLTEF
QCVSSALIVQCPSPTDRARWLEKTQQAQITLQKLKAEEYVQQKRELLALYRDQDRESPNT
RPSTPSLEGSQSSAEGRTPEFSTIIPHLVVTEDTDEDAPFVPDDTSDSGYGTLIPGTPMG
SRSPLSRLRQRALRRDPRLTFSTLDLRDVPLRPQPPNPQAPQRRSAPELPEGILKGASLP
QGDPPTWSEEEEGASVRGNVVVETLHRAQLRGQLPSSPAHADSAGESPWESSGEEEEEGP
LFLRAGHTSLHPMRAEDMLREIREELASQRIEGAAEPRDSRPRKLTRAQLQRMRGPHIIH
LDTPLSTS
Download sequence
Identical sequences ENSPANP00000005935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]