SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006572 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006572
Domain Number 1 Region: 421-637
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.03e-48
Family DBL homology domain (DH-domain) 0.00011
Further Details:      
 
Domain Number 2 Region: 627-776
Classification Level Classification E-value
Superfamily PH domain-like 6.16e-20
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 
Domain Number 3 Region: 781-847
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-16
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006572   Gene: ENSPANG00000022038   Transcript: ENSPANT00000010430
Sequence length 867
Comment pep:known_by_projection chromosome:PapAnu2.0:2:131774096:131913653:-1 gene:ENSPANG00000022038 transcript:ENSPANT00000010430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGESEVDFSSNSITPLWRRRSIPQPQLLGRSKPRPQSYQSPNGLLITDFPVEDRGTLPA
AQTLAQVPTDSDSRTIHRSPLLLGAQRRAVANGGTASPEYRAASPRLRRPKSPKLPKAVP
GGSPKSPANGPVTLPAPPPPVLRSPRTPNAPAPCTPEEDPTGLNASPMPSPTANGLAANN
DSPGSGSQSSQKAKEPERGLSPAPQKSSSEQKLPLQRLPSQENELLENPSVVLSTNSPAA
LKVGKQQIIPKSLASEIKISKSNNQNVEPHKRLLKVRSMVEGLGGPLGHAGEESEFDNDV
DSPGSLRRGLRSTSYRRAVVSGFDFDSPTSSKKKNRMSQPVLKAVMEDKEKFSSLGRIKK
KMLKGQGTFDGEENAVLYQNYKEKALDIDSDEESEPKEQKSDEKIVIHHKPLRSTWSQLS
AVKRNGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELSDTMTKTERHH
LFSNITDVCEASKKFFIELEARHQNNIFIDDISDIVEKHTASTFDPYVKYCTNEVYQQRT
LQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDRICTEKKIENIQ
TCLNCVVQCRKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRWLVKRGELTA
YVEDTVLFSRRTSKQQVYFFLFNDVLIITKKKSEESYNVNDYSLRDQLLVESCDNEELNS
SPGKNSSTVLYSRQSSASHLFTLTVLSNHANEKVEMLLGAETQSERARWITALGHSSGKP
PADRTSLTQVEIIRSFTAKQPDELSLQVADVVLIYQRVSDGWYEGERLRDGERGWFPMEC
AKEITCQATIDKNVERMGRLLGLETNV
Download sequence
Identical sequences ENSPANP00000006572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]