SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006706 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006706
Domain Number 1 Region: 676-903
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 272-448
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4.97e-57
Family Regulator of G-protein signaling, RGS 0.0000000151
Further Details:      
 
Domain Number 3 Region: 907-1041
Classification Level Classification E-value
Superfamily PH domain-like 1.45e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 2-43
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000473
Family PDZ domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000006706
Domain Number - Region: 73-82
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006706   Gene: ENSPANG00000023013   Transcript: ENSPANT00000028257
Sequence length 1484
Comment pep:known_by_projection chromosome:PapAnu2.0:1:130829748:130878016:-1 gene:ENSPANG00000023013 transcript:ENSPANT00000028257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSSPSSVGISGLQQDPFP
AGAPRITPVIPQPPPPPPLPPPQRITGPKPLQDPEVQKHATQILRNMLRQEEKELQRICE
VYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSVDVLPLYGDTSQRPSEGRLSLDSQE
GDSGLDSGTERFPSLSESLMNRNSILSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPST
GDQGVDQSPKPLIIGPEEDCDPGYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPS
PLLFYLCAEVYQQTSPKDSRNLGKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDAR
GVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALG
DILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKS
SNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQY
DAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVD
MDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLE
DDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDL
IFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFD
GPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISE
MQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQK
RLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQK
QDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYE
LVALTSSDKNTWMELLEEAVRNATRHPGAAPMPIHPPPPGPQEPAHQGLTPSRVELDDSD
VFHGEPEPEELPGGTGPQQRVQGKHPVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGI
RTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWSLLPGHTMETQAAREPEDDLTPTP
SVISVTSHPWDPGSPGQAPPGGQGDNTQLAGPEGERPEQEDVGLCSLEHLPPRTRNSGIW
ESPELDRNLAEEASSTEAAGGYKVVRKAEVAGSKVVPALPESGQSEPGPPEVEGGTKATG
NCFYVSMPTGPLDSSTDHSGVPTSPPQPDSVPAGQAEPRPQLQGGNGDPRRLSRSPPSLA
LRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGS
LSPPTKEPLASDSRNSHELGPCPEDGSDAPLEDSAADAAASPGP
Download sequence
Identical sequences ENSPANP00000006706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]