SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000006863 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000006863
Domain Number 1 Region: 266-486
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-56
Family DBL homology domain (DH-domain) 0.0000854
Further Details:      
 
Domain Number 2 Region: 476-620
Classification Level Classification E-value
Superfamily PH domain-like 4.59e-18
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 3 Region: 629-689
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000494
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000006863   Gene: ENSPANG00000006401   Transcript: ENSPANT00000029185
Sequence length 709
Comment pep:known_by_projection chromosome:PapAnu2.0:1:6299667:6324291:1 gene:ENSPANG00000006401 transcript:ENSPANT00000029185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRHSDISLEEKLLEHRFHSELRLDTSGNPASGLPMVRGSLRVRDNAVFQPEVPAPPQP
RSPGHEEPRPIVLSTESPAALKLGTQQLIPKSLAVASRAKTPARHQSFGAAVLSREAARR
DPKLLPAPSFSLDDMDMDKDPGGMLRRNLRNQSYRAAIKGLGKPGGQGDAIPLSPKLQAL
AEEPSQPHTRNPAKNKKTLGRKRGHKGSFKDDPQLYQEIQERGLNTSQESDDDILDESSS
PEGARKMDTTIVVKSYRPAQITWSQLPEVVELGILDQLSTEERKRQEAMFEILTSEFSYQ
HSLSVLVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDIS
DILEEHAEKHFHPYIAYCSNEVYQQRTLQKLISSNAAFREVLREIERRPACGGLPVLSFL
ILPMQRVTRLPLLTDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYT
LHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKK
KSEESYVVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHAFQVTLLRNSEGRQEQLLL
SSDSASDRARWIVALTHSERQWQGLTNKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQ
QEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV
Download sequence
Identical sequences A0A096N3F1
ENSPANP00000006863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]