SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000007943 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000007943
Domain Number 1 Region: 174-355
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.85e-50
Family DBL homology domain (DH-domain) 0.0000123
Further Details:      
 
Domain Number 2 Region: 363-489
Classification Level Classification E-value
Superfamily PH domain-like 4e-30
Family Pleckstrin-homology domain (PH domain) 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000007943   Gene: ENSPANG00000024375   Transcript: ENSPANT00000018659
Sequence length 597
Comment pep:known_by_projection chromosome:PapAnu2.0:11:53186328:53194251:1 gene:ENSPANG00000024375 transcript:ENSPANT00000018659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPPDRPAPGRTDRILGVMGSMLRACALPGQEGPPRRSPLGSGDTEPESERTEGDHRRDR
EDEVLAWALQPESYSIAGSEGSISASAASGLVSGLRRWLDHSKHCLSVETEADSRQAGPY
ENWMLEPALATGEELPELTLLTTLLDGPGDKTQPPEEEALSQAPESEVEQKKAALERSMY
VLSELVETEKMYVDDLGQIVEGYMATMAAQGVPESLRGRDRIVFGNIQQIYEWHRDYFLQ
ELQRCLKDPDWLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFGDSYFEELRQQLGHRLQ
LNDLLIKPVQRIMKYQLLLKDFLKYYNRAGMDTAELEQAVEVMCFVPKRCNDMMTLGRLR
GFEGKLTAQGKLLGQDTFWVIEPEAGGLLSSRGRERRVFLFEQIIIFSEALGGGVRGGTQ
PGYVYKSSIKVSCLGLEGNLQGDPCRFALTSRGPEGGIQRYVLQAADPAISQAWIKHVAQ
ILESQRDFLNALQSPIEYQRRESQTNSLGRPGGPGVGSPGRIRLGDQAQGSTHTPINGSL
PSLLLSPKGEVARAPLPLDKQALSDIPQAPHDSPPVSPTPNTPPCQARLAKLDEDEL
Download sequence
Identical sequences ENSPANP00000007943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]