SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008256 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008256
Domain Number 1 Region: 512-724
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.49e-51
Family DBL homology domain (DH-domain) 0.00043
Further Details:      
 
Domain Number 2 Region: 227-348
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-36
Family Third domain of FERM 0.00047
Further Details:      
 
Domain Number 3 Region: 849-1002
Classification Level Classification E-value
Superfamily PH domain-like 2.41e-33
Family Pleckstrin-homology domain (PH domain) 0.0014
Further Details:      
 
Domain Number 4 Region: 709-834
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-29
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 5 Region: 126-226
Classification Level Classification E-value
Superfamily Second domain of FERM 1.18e-27
Family Second domain of FERM 0.00012
Further Details:      
 
Domain Number 6 Region: 46-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.85e-21
Family First domain of FERM 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008256   Gene: ENSPANG00000019972   Transcript: ENSPANT00000012592
Sequence length 1032
Comment pep:known_by_projection chromosome:PapAnu2.0:12:103148487:103290585:1 gene:ENSPANG00000019972 transcript:ENSPANT00000012592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEIEGTYRVLQTAGTRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTVEIFDT
EPKCDGQILLTQVWKRLNLVECDYFGLEFQNTQSYWIWLEPMKPIIRQIRRPKNVVLRLA
VKFFPPDPGQLQEEYTRYLFALQLKRDLLEERLTCADTTAALLTSHLLQSEIGDYDEMLD
REHLKANEYLPGQQHCLEKILEFHQKHVGQTPAESDFQVLEIARKLEMYGIRFHMASDRE
GTKIQLAVSHMGVLVFQGTTKINTFNWSKVRKLSFKRKRFLIKLHPEVHGPYQDTLEFLL
GSRDECKNFWKICVEYHTFFRLLDQPKPKAKAVFFSRGSSFRYRRHSKTHMSIRALTADL
PKQSISFPEGLRTPASPSSANTSFYSLSPSTLVPPGLPEFKDSSSSLTEPQVSYIKSPAA
ERSSGAVAGGPDTPSAQPVGPPALQPGPGLSTKSPQPSPSSRNSPLSLSPAFQVPLGPAE
QGSSPLLSPVLSDAGGAGMDYEEPRHKRMPADEAYFIVKEILATERTYLKDLEVITVWFR
SAVVKEDAMPATLMTLLFSNIDPIYEFHRGFLREVEQRLALWEAPSKAHTKGGHQRIGDI
LLRNMLQLKEFTSYFQRHDEVLTELEKATKRFKKLEAVYKEFELQKVCYLPLNTFLLKPI
QRLLHYRLLLRRLCGHYTPGHHDYADCHDALKAITEVTTTLQHILIRLENLQKLTELQRD
LVGVENLIAPGREFIREGCLHKLTKKGLQQRMFFLFSDMLLYTSKGVAGTSHFRIRGLLP
LRGMLVEESESEWSVPHCFTIYTAQKTIMVAASTRLEKEKWMLDLNNAIQAAKSGGDTAP
ALPGSTVCTHPPRSPNEVSLEQESEDDARGARSSLEGHGQHRANTTMHVCWYRNTSVSRA
DHSAAVENQLSGYLLRKFKNSHGWQKLWVVFTNFCLFFYKTHQDDYPLASLPLLGYSVSI
PQEADGIHKDYVFKLQFKSHVYFFRAESKYTFERWMEVIQGASSSARRAPSIVQDGPQPS
SGLEGMVRGKEE
Download sequence
Identical sequences A0A096N6X5
ENSPANP00000008256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]