SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000008698 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000008698
Domain Number 1 Region: 827-1062
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-56
Family DBL homology domain (DH-domain) 0.0000359
Further Details:      
 
Domain Number 2 Region: 1059-1188
Classification Level Classification E-value
Superfamily PH domain-like 1.2e-34
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 645-700
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000133
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0085
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000008698
Domain Number - Region: 133-218
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000363
Family Ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000008698   Gene: ENSPANG00000012020   Transcript: ENSPANT00000001317
Sequence length 1704
Comment pep:known_by_projection chromosome:PapAnu2.0:6:67706281:68022482:1 gene:ENSPANG00000012020 transcript:ENSPANT00000001317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELSCSEAPLYGQMTVYAKFDKNVYLPEDAEFYFTYDGSHQRHVMIAERIEDNVLQSSIP
GHGLQETVTVSVCLCSEGYSPVTMGSGSVTYVDNMACRLARLLVTQANRLTACSHQTLLT
PFALTAGALPALDEELVLALTHLELPLEWTVLGSSSLEVSSHRESLLHLAMRWGLAKLSQ
FFLRLPGGVQALALPNEDGATPLDLALRGGHSKLVEDVTNFQGRWLPSFSRVQLSEEASL
HYIHSSETLTLTLNHTAEHLLEADIKLFRKYFWDRAFLVKAFEQETRPEERTAMPSSGAE
TEEEVKNSVSSSSAAEKEDVKCVKSLVVQQNEHEDQHSLDLDRSFDVLKKSKPPSTLLAA
GRLSDMLNGGDEVYANCMVIDQVGDLDISSINIEGITATTSPESRGCTLGPQSSKHTLPT
ETSPSVYPLSENDEGTAHTEAQRSFMSPSSSCASNLNLSFGWHGFEKQQSHLKKRSSSLD
ALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNAEPDFNISRAESLPLSS
NLQSKESLLSGVRSRSYSCSSPKISLGKTRLVRELTVCNSSEEQRAYSLSEPPREKRIQE
EEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKSKDAKDKEKLNRHQFAPGTF
SGVLQCLVCDKTLLGKESLQCSNCNANVHKGCKDAAPPCTKKFQEKYNKNKPQTILGNSS
FRDIPQPGLSLHPSSSMPVGLPTGKRETAGHVHPLSRSVPGTTLERRSATSLESESDSNS
CRSRSHSDELLQSMGSSPSTESFIMEDVVDYSLWSDLSSDAQEFEAESWSLVVDPSFCNR
QEKDVIKRQDVIFELMQTEMHHIQTLFIMSEIFRKGMKEELQLDHSTVDKIFPCLDELLE
IHRLFFYSMKERRQESCAGSDRNFVIDRIGDILVQQFSEENASKMKKIYGEFCSHHKEAV
NLFKELQQNKKFQNFIKLRNSNLLARRRGIPECILLVTQRITKYPVLVERILQYTKERTE
EHKDLCKALCLIKDMIATVDLKVNEYEKNQKWLEILNKIENKTYTKLKNGHMFRKQALMS
EERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQKPSVISLQKLI
AREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCPEEKGGRTSESD
EDKRKAEARVAKIQQCQEILTNQDQQICAYLEEKLHIYAELGELSGFEDVHLEPHLLIKP
DPGDPPQAASLLAAALKEAESLQVAVKASQMGDVSQSREDSCGDSVLVDTLSSHDVPGSP
TASLVTGGREERGCSDVDPGIQGVVTDLAVSDAGEKVECRNFPGSSQSEIIQAIQNLTRL
LYSLQAALTIQDSHIEIHRLVLQQQEGLSLGHSVLRGGPLQDQKSRDADRQHEELANVHQ
LQHQLQQEQRRWLRRCDQQQRAQAAKESWLQERERECQSQEELLLRSRGELDLQLQEYQH
SLERLREGQRLVERERARMQAQQSLLSHWKHGRQRSLPAVFLPGGPEVMELNRSESLCHE
NSFFINEALVQMSFNTFNKPNPSVIHQDATYPTTRSPSDLVRTSENQVDLKMDPSQPSNV
SHELWTAAAGSSHQIFPFHESSKDSCKNDLETSHTESPTPHDSNSHRSQLQAFITEGKLN
LPARTMTRQDGEPGDGAKENIVYL
Download sequence
Identical sequences ENSPANP00000008698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]