SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000009011 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000009011
Domain Number 1 Region: 1-187
Classification Level Classification E-value
Superfamily EF-hand 1.21e-52
Family Calmodulin-like 0.000000791
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000009011   Gene: ENSPANG00000006453   Transcript: ENSPANT00000015194
Sequence length 191
Comment pep:known_by_projection chromosome:PapAnu2.0:1:41867245:41876431:-1 gene:ENSPANG00000006453 transcript:ENSPANT00000015194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKTNSKLAPEVLEDLVQNTEFSEQELKQWYKGFLKDCPSGILNLEEFQQLYIKFFPYGD
ASKFAQHAFRTFDKNGDGTIDFREFICALSVTSRGSFEQKLNWAFEMYDLDGDGRITRLE
MLEIIEAIYKMVGTVIMMRMNQDGLTPQQRVDKIFKKMDQDKDDQITLEEFKEAAKSDPS
IVLLLQCDMQK
Download sequence
Identical sequences A0A096N8T0 A0A0D9S7P3 A0A1S3WGM8 A0A286XBG1 A0A2I2U624 A0A2J8Y6B6 A0A2K5D552 A0A2K5KE81 A0A2K5LW38 A0A2K5PM62 A0A2K6B916 A0A2K6ETY7 A0A2K6K6N8 A0A2K6QSY2 A0A2K6TWS2 F2Z5V9 F6W6H3 F7AZV3 G5C4Y8 G7MG96 G7NUC4 H2PYR0 J9P575 L5LL21 L8J5S6 P29104 Q5R6S5 Q9UM19 W5QFS9
ENSPVAP00000002004 ENSECAP00000016666 ENSOPRP00000009768 ENSP00000361935 ENSP00000481834 ENSPANP00000009011 ENSPVAP00000002004 ENSPTRP00000001001 ENSP00000361935 ENSCPOP00000002223 ENSECAP00000016666 ENSCAFP00000040751 ENSP00000361935 ENSOPRP00000009768 ENSETEP00000001729 ENSFCAP00000005601 ENSCJAP00000004691 HGL_H00000361935 ENSFCAP00000005601 ENSETEP00000001729 ENSBTAP00000019321 ENSBTAP00000019321 ENSSSCP00000021803 NP_001092852.1.59421 NP_001092852.1.76553 NP_001269325.1.87134 NP_001269325.1.92137 NP_057341.1.87134 NP_057341.1.92137 XP_001161893.2.37143 XP_002750689.1.60252 XP_003462333.2.53824 XP_003937070.1.74449 XP_003989939.2.62641 XP_004001880.1.66739 XP_004371960.1.4749 XP_004426059.1.5094 XP_004591603.1.84141 XP_004641119.1.9945 XP_004705000.1.18182 XP_004851091.1.39548 XP_005395320.1.28644 XP_005543919.1.63531 XP_005543920.1.63531 XP_005628954.2.84170 XP_005628955.1.84170 XP_005628956.1.84170 XP_005665302.1.46622 XP_005886808.1.15283 XP_005970515.1.78601 XP_006077580.1.26621 XP_006188088.1.101512 XP_006219495.1.17985 XP_006768532.1.95426 XP_006867639.1.41390 XP_006886557.1.29581 XP_007164781.1.59432 XP_007527151.1.11023 XP_008149396.1.99482 XP_008538202.1.77740 XP_008829025.1.79516 XP_008999201.1.60252 XP_009250259.1.23681 XP_009452769.1.37143 XP_010345860.1.74449 XP_010345861.1.74449 XP_010352494.1.97406 XP_010861037.1.44457 XP_010958122.1.22495 XP_011761915.1.29376 XP_011761916.1.29376 XP_011810640.1.43180 XP_011810641.1.43180 XP_011934728.1.92194 XP_012294585.1.9421 XP_012294586.1.9421 XP_012418657.1.74151 XP_012502217.1.63892 XP_012635318.1.48125 XP_012635319.1.48125 XP_013975170.1.84170 XP_014695691.1.49734 XP_014991415.1.72884 XP_014991421.1.72884 XP_015995569.1.101085 XP_015995571.1.101085 XP_015995572.1.101085 XP_015995573.1.101085 XP_016045485.1.11023 XP_016074365.1.3490 XP_016856936.1.92137 XP_017363467.1.71028 XP_017363468.1.71028 XP_017710358.1.44346 XP_017710360.1.44346 XP_017897669.1.57651 XP_019512361.1.44202 XP_019574342.1.88060 XP_019813318.1.53367 XP_020036439.1.5219 XP_020135839.1.48125 XP_021539425.1.83697 XP_849680.2.84170 ENSPCAP00000014738 gi|7705419|ref|NP_057341.1| 10141.ENSCPOP00000002223 9598.ENSPTRP00000001001 9606.ENSP00000361935 9685.ENSFCAP00000005601 9796.ENSECAP00000016666 9823.ENSSSCP00000003968 9913.ENSBTAP00000019321 ENSCAFP00000040751 ENSOARP00000021577 ENSSSCP00000021803 ENSCJAP00000004691 ENSPTRP00000001001 ENSPCAP00000014738 ENSCPOP00000002223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]