SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010038 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010038
Domain Number 1 Region: 26-235
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.28e-46
Family DBL homology domain (DH-domain) 0.00027
Further Details:      
 
Domain Number 2 Region: 266-462
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-37
Family BAR domain 0.01
Further Details:      
 
Domain Number 3 Region: 602-682
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.00059
Further Details:      
 
Domain Number 4 Region: 504-578
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000171
Family SH3-domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010038   Gene: ENSPANG00000013089   Transcript: ENSPANT00000011475
Sequence length 685
Comment pep:known_by_projection chromosome:PapAnu2.0:6:143165147:143200143:1 gene:ENSPANG00000013089 transcript:ENSPANT00000011475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLLFPERADMAKHGADEPSCRSGSLDGEGRASEDRSLLRQRLAVQELIDTEVSYLHMLQ
LCASDIRSRLQQLPQGDLDVLFSNIDDIIKVNSRFLHDLQETACKKEEQVQLVGNLFLEF
QEELEQVYKVYCASYDQALLLVDTYRKEPELQRHIQGIIEAVVPQAGSSGLSFLLVIPLQ
RITRYPLLLQKILENTVPDASAYPVLQRAVAALQDVNTNINEYKMRKEVASKYTKVEQLT
LRERLARINTHTLSKKTTRLSQLLKQEAGLIPRTEDKEFDDLEERFQWVSLCVTELKNNV
AAYLDNLQTFLCFRPHEYSLDIPEGPAVQYCNLARDLQLEAFLTFKQRLEGLVWQPLCSL
AKALLGPQNLIKKRLDKLLDFERLEEKLLEVGSVTYQEEAARHTYQALNSLLVAELPQFN
QLVVQWLGQILRTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQ
LRSFQETFEKVLPPPTTQPLLPGSERQAQALLSRYGPGKLYQVTSNISGTGTLDLTLPRG
QIVALLQNKDTKGNSNRWLVDTGGHRGYVPAGKLQLYHVVPSAEELRRQVGLNKDPRCLT
PEPSPAPAPSIPTVNQVIAVYPFVARSSHEVSLQAGQPVTILEAQDKKGNPEWSLVEVNG
QRGYVPSGFLARAQSPVLWGWSLPS
Download sequence
Identical sequences ENSPANP00000010038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]