SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000010408 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000010408
Domain Number 1 Region: 435-657
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-55
Family DBL homology domain (DH-domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 221-354
Classification Level Classification E-value
Superfamily BRCT domain 2.18e-23
Family DNA topoisomerase II binding protein 1, TopBP1 0.055
Further Details:      
 
Domain Number 3 Region: 138-250
Classification Level Classification E-value
Superfamily BRCT domain 1.31e-18
Family DNA ligase 0.028
Further Details:      
 
Domain Number 4 Region: 648-793
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000151
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000010408   Gene: ENSPANG00000018155   Transcript: ENSPANT00000023910
Sequence length 917
Comment pep:known_by_projection chromosome:PapAnu2.0:2:112898233:112969260:-1 gene:ENSPANG00000018155 transcript:ENSPANT00000023910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSVLTSTTGRTSLADSSIFDSKVTEISKENLLIESTSYVEEEMPQIETRVILVQEAG
KQEELIKALKTVKIMEVPVIKIKESCPGKSDEKLIKSVINMDIKVGFVKMESVEEFEGLD
SPEFENVFVVMDFQDSVFNDLYKADCRVIGPPIVLNCSQKGEPLPFSCRPLYCTSMMNLV
LCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRVAVSLGTPIMKP
EWIYKAWERRNEQDFCAAVDDFRNEFKVPPFQDCILSFLGFSDEEKTNMEEMTEMQGGKY
LPLGDERCTHLVVEENIVKDLPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSMLSLNTPNSNRKRRRLKETLAQLSRETDVSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINYGDTPKSCTKSSKNSTPVPSKQSARWQVAKELYQTESNYVNILATIIQLFQV
PLEEEGQCGGRILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTADENPDKSTLEKAIGSLKEVMMHINEDKRKTEAQKQIFDVVYEVDG
CPANLLSSHRSLIQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHGQ
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSDELPK
ENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMTSHGSHGSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPS
FFERRSHTLSRSTTHLI
Download sequence
Identical sequences A0A096NC69
ENSPANP00000010408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]